KEGG   Methylomicrobium alcaliphilum: MEALZ_1562Help
Entry
MEALZ_1562        CDS       T01649                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MEALZ_1562 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MEALZ_1562 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MEALZ_1562 (thrC)
Enzymes [BR:mah01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MEALZ_1562 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1777469..1778563
Genome map
AA seq 364 aa AA seqDB search
MTIRKRYTGLIETYRDRLPVADDTRLISLGEGNTPLIQLQNIPRLIGKDVDIYVKFEGLN
PTGSFKDRGMTMAVTKAVEEGSQAIICASTGNTSASAAAYAVRAGIKAFVLIPEGKIALG
KLAQTLMYGAKIIQINGNFDQGMALVKEIVDHAPVSIVNSINPFRLEGQKTAAFEIIDEL
GTAPDYHCLPVGNAGNISAYWKGYKEYSTDIGSLKAVTNKRPVMCGYQAAGAAPFIAREM
IDHPETVATAIRIGRPQSWDLAWTAQRESEGWFAAMTDEQILAAQKLLSSNEGVFCEPAS
AASLAGALHDIELGNIPEGSTIVCTLTGNGIKDPDIAIKQCKDAHPVTIEADLDAVKKAI
LDSL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacaattcgtaaacgctatacaggtttaatcgaaacttatagagatcgactgccggtc
gctgatgatactcgcttgatcagtctgggcgaaggtaatacacctttgatacagctgcaa
aacattccaagattgatcggtaaggatgtcgacatctacgtcaaattcgaaggcttgaat
ccgaccggttcgttcaaggaccgcggcatgacgatggcagtcacgaaagcggtcgaagag
ggcagtcaggcgatcatttgcgcatcgaccggcaacacttcggcttccgcggcggcctat
gcggtacgtgcaggcatcaaagcgttcgtgttgattccggaaggcaaaatcgcgttgggt
aaattagcgcaaactttgatgtacggagccaagatcattcagatcaacggcaatttcgat
cagggcatggctttagttaaggaaatcgtcgatcatgcgccggtttcaatcgtcaattcg
atcaatccgttccgtctcgaaggacagaaaaccgcagcattcgaaatcatcgacgaactg
ggtaccgcgcccgattatcactgtctgccggtcggcaatgccggcaatatttcggcctat
tggaaaggctataaggaatattcgaccgatatcggttcgctgaaagccgtgacgaataag
cgtcccgtgatgtgcggttatcaagcggccggcgccgcgcctttcatcgccagggaaatg
atcgatcatcccgaaacggtcgcgaccgcgatacgcatcggacgcccgcaatcctgggat
ttggcttggaccgcgcaacgcgaatcggaaggttggtttgccgcgatgaccgacgagcaa
attttggcagcgcaaaaattgttgagttcgaacgaaggtgtattttgcgagcctgcctcg
gcggcatcgctggccggcgcgttgcacgatatcgaattggggaatattcccgaaggcagc
acgatcgtttgcacattgaccggcaacggcatcaaagaccccgatatcgcgatcaagcaa
tgtaaagacgcgcacccggttacgatcgaagccgatttagacgcagtcaagaaagcgata
ctcgatagtctataa

DBGET integrated database retrieval system