KEGG   Methylomicrobium alcaliphilum: MEALZ_1579Help
Entry
MEALZ_1579        CDS       T01649                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
mah00020  Citrate cycle (TCA cycle)
mah00310  Lysine degradation
mah01100  Metabolic pathways
mah01110  Biosynthesis of secondary metabolites
mah01120  Microbial metabolism in diverse environments
mah01130  Biosynthesis of antibiotics
mah01200  Carbon metabolism
Module
mah_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mah_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MEALZ_1579 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MEALZ_1579 (sucB)
Enzymes [BR:mah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MEALZ_1579 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: CCE23266
UniProt: G4SZC9
Position
complement(1799340..1800587)
Genome map
AA seq 415 aa AA seqDB search
MSIEVLVPNLPESVSDATLINWQKKPGDRVTKNENLVDLETDKVVLEVPAPESGVLTKIL
KNDGDIVVGSEVLAIIDPQAAATEESAATPASDTDNEPQQTAEKEPETASANIPLSPAVR
RLVVEKNLDPSAISGSGKHGRITKNDILEYLQDEPVLETSPRTKTPPESVQTDSKPATIP
ASLRPEQRVPMTRLRAKIAERLLQAQQNAAMLTTFNEVDMHHVMDLRNQYKNRFEQTHNI
KLGFMSFFVKASIEALKKFPTINASIDGNDIIYHGYYDIGIAVSTPRGLIVPVLRDADQL
DFAGIEKNIANFGKKAKEGNISFEDLTGGTFTITNGGIFGSMLSTPILNPPQCAILGMHA
IKERPVVENGQIVVRPIMYLALSYDHRLVDGREAVQFLVTIKECLESPAHLLLNI
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgaagtcctcgttcctaatctgcctgaatccgtttccgatgccacactcatt
aactggcaaaaaaaacccggggatagagtcacaaaaaacgaaaatctcgtcgatctcgaa
accgataaagtcgtgctcgaagtgcctgcgcccgaatcaggcgttttaacgaaaatcctg
aaaaacgacggcgacattgttgtcggcagcgaagtactggctatcatcgacccgcaagcg
gccgcgacagaagaaagcgccgcaacgccagcaagcgataccgacaatgaaccgcaacag
accgccgaaaaagaaccggaaaccgcatcggccaacattcctttgagccccgcggttcga
aggctcgttgttgaaaaaaatctcgacccctcggccattagcggctcgggaaagcacggc
cgtattaccaaaaacgatattctcgaatatttgcaggacgaaccggttctcgaaacctcg
cctcgtacaaaaacaccgccggaatccgtgcaaacggattcgaaaccggccacgattcca
gcttcattaagacccgaacaacgggtcccaatgactcgacttagagccaagattgccgaa
cgcttgctgcaagcgcaacaaaacgccgcgatgctaacgactttcaacgaagtcgacatg
catcatgtgatggatttacgaaaccaatataaaaaccgcttcgagcaaacgcacaatatc
aaattgggcttcatgtcttttttcgtcaaagcatcgatcgaggccttgaaaaaattcccg
actattaatgcctcaattgacggtaacgacattatctatcacggctactacgatatcggc
attgcggtcagtacaccgcgcggattgattgtgccggttcttcgcgatgccgatcaatta
gactttgccggcatcgaaaaaaatatcgccaatttcggcaaaaaagccaaagaaggcaac
attagttttgaagacctgaccggcggtacgtttacaataaccaatggcggcattttcggc
tcgatgctatcgactccgatattaaatccgccgcaatgcgcgatcttaggcatgcatgca
atcaaggagcggcccgtggttgaaaatggacaaatagtcgttagaccaatcatgtatctt
gctttatcttacgatcatcgcttggtcgacggccgcgaagcggtgcaatttttggtcacc
atcaaagagtgcctggaatctccagcgcacttattgctaaacatataa

DBGET integrated database retrieval system