KEGG   Methylomicrobium alcaliphilum: MEALZ_1717Help
Entry
MEALZ_1717        CDS       T01649                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase 2
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mah  Methylomicrobium alcaliphilum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1975811..1976548
Genome map
AA seq 245 aa AA seqDB search
MNKQFRLVIFAIMLFGVANYAMAGETAYERQRNRLIDMIQADVRSTSYFLGKDALDEKVL
QALRKVPRHEFVPEAQRPNAYLNRPLPIGHGQTISQPYIVAIMTDLLELDENSRVLEIGT
GSAYQAAVLAEVAGSVYTIEIIEALADQAARDLKRLGYDKVQSRAGDGYYGWEGAAPFDA
IMVTAAASHIPPPLIKQLKPGGRMIIPVGGRFTVQHLVLVNKDQENRITSRQLLPVRFVP
LTGDR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaattccgattagtaattttcgcaatcatgttgtttggtgttgccaattat
gcaatggccggcgagacggcctatgaacggcaacgcaatagattgatcgatatgattcag
gcggatgtcaggtcgacgagctattttctcggtaaagacgcattagacgagaaagttttg
caggcattgcgtaaagtgccccgtcatgaattcgtgccggaggcgcagcggcccaatgcc
tatttaaacaggcccttgccgatcgggcacggacaaacgatctctcagccttacatcgtg
gcgatcatgaccgatttgttggagcttgatgaaaatagccgcgtattggaaatcggtacc
ggttcggcttaccaggcggctgttttggcagaagtggccggtagcgtgtatacgatagaa
attatcgaggctttggcggatcaggccgcgcgcgatcttaaacgtctaggctacgataaa
gtgcaatcgcgcgcgggcgacggatattacggttgggaaggggccgcgccgttcgatgcg
atcatggtgaccgcagccgccagtcatattcctccgccgctgatcaaacaattgaaaccg
ggcgggcgcatgatcattccggtcggcggccgttttaccgtacagcatctcgtgctggtg
aacaaggaccaagaaaaccgcattacgagccgccagttattgccggttagatttgtgcct
ttaacgggagatcgttaa

DBGET integrated database retrieval system