KEGG   Methylomicrobium alcaliphilum: MEALZ_2252Help
Entry
MEALZ_2252        CDS       T01649                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mah  Methylomicrobium alcaliphilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2571750..2572802
Genome map
AA seq 350 aa AA seqDB search
MPFRTDYDYSTEENIQFMHRIVKLMMQHKITPTPINYAVFYEYTASYNDNLKAAVDQLIA
EKNPFDMETGLALYKKHICHAALVSFDKINQDIQRIIDQTEKSVNETQQKASEASDSFEK
KSIRLENITNLEELKTVLSEIAGETKSLIDTSDHFKSQLEVANKEMEQLRKELSKVKEAA
TVDALTGLLNRGTFDETLTNLLEESSDKDICLTLLDLDHFKQVNDKFGHLIGDNVLKFTA
SLLKKYSEKHHYVARYGGEELAIIMPDTSLSVAQDIAEKIRTSLQNSRLKRKNSNESIGT
ITLSIGIATRKQNDTIESFILRADQALYKAKETGRNKVICEWAMDAISHC
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttagaaccgattacgactactccaccgaagaaaacattcaatttatgcatcgc
atcgttaaactcatgatgcagcataaaatcactccgaccccaatcaattatgccgtattt
tacgaatacaccgcgagttacaatgacaacctcaaggccgctgtcgaccaactaattgcc
gaaaaaaatcctttcgatatggagaccggcctggctttatataaaaaacatatctgtcac
gcggcactggtatcgttcgacaaaatcaatcaagatatccaaaggatcatcgatcaaacc
gaaaaatcggttaatgaaactcagcaaaaagcatcagaagccagcgatagttttgagaaa
aaatcgatacgcctggaaaacataacgaatttggaagaattgaaaaccgtactgtcggaa
attgccggcgaaacaaagagcctgatagataccagcgatcattttaagtcacaactggaa
gtcgctaataaagaaatggaacagctgcgcaaggaactttcaaaagttaaggaagcggcg
actgtcgacgctctgaccggactattgaatcgcggaacatttgatgagacgctaaccaac
ctcctcgaggaatcgagcgacaaagacatttgcctgacactattggatctggaccacttc
aagcaggtcaatgacaaattcggacatttaatcggcgacaatgtgttgaaattcaccgca
tcgctactgaaaaagtatagcgaaaaacatcattatgttgctcgttacgggggtgaggaa
ctggccattatcatgcccgacacttcattgtccgtagctcaggatattgctgaaaaaatc
agaacgtcattacaaaacagcagactaaaacgcaaaaacagcaacgaatcgatcggcacc
attacgttatcgatcggtatcgcgactcgaaaacaaaacgatacgattgaaagctttatc
ttacgcgccgatcaggccctatataaagccaaagaaaccgggcgtaacaaagttatctgc
gaatgggccatggacgcaatcagccattgttaa

DBGET integrated database retrieval system