KEGG   Methylomicrobium alcaliphilum: MEALZ_2252Help
Entry
MEALZ_2252        CDS       T01649                                 

Definition
(RefSeq) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mah  Methylomicrobium alcaliphilum
Brite
Enzymes [BR:mah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     MEALZ_2252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2571750..2572802
Genome map
AA seq 350 aa AA seqDB search
MPFRTDYDYSTEENIQFMHRIVKLMMQHKITPTPINYAVFYEYTASYNDNLKAAVDQLIA
EKNPFDMETGLALYKKHICHAALVSFDKINQDIQRIIDQTEKSVNETQQKASEASDSFEK
KSIRLENITNLEELKTVLSEIAGETKSLIDTSDHFKSQLEVANKEMEQLRKELSKVKEAA
TVDALTGLLNRGTFDETLTNLLEESSDKDICLTLLDLDHFKQVNDKFGHLIGDNVLKFTA
SLLKKYSEKHHYVARYGGEELAIIMPDTSLSVAQDIAEKIRTSLQNSRLKRKNSNESIGT
ITLSIGIATRKQNDTIESFILRADQALYKAKETGRNKVICEWAMDAISHC
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttagaaccgattacgactactccaccgaagaaaacattcaatttatgcatcgc
atcgttaaactcatgatgcagcataaaatcactccgaccccaatcaattatgccgtattt
tacgaatacaccgcgagttacaatgacaacctcaaggccgctgtcgaccaactaattgcc
gaaaaaaatcctttcgatatggagaccggcctggctttatataaaaaacatatctgtcac
gcggcactggtatcgttcgacaaaatcaatcaagatatccaaaggatcatcgatcaaacc
gaaaaatcggttaatgaaactcagcaaaaagcatcagaagccagcgatagttttgagaaa
aaatcgatacgcctggaaaacataacgaatttggaagaattgaaaaccgtactgtcggaa
attgccggcgaaacaaagagcctgatagataccagcgatcattttaagtcacaactggaa
gtcgctaataaagaaatggaacagctgcgcaaggaactttcaaaagttaaggaagcggcg
actgtcgacgctctgaccggactattgaatcgcggaacatttgatgagacgctaaccaac
ctcctcgaggaatcgagcgacaaagacatttgcctgacactattggatctggaccacttc
aagcaggtcaatgacaaattcggacatttaatcggcgacaatgtgttgaaattcaccgca
tcgctactgaaaaagtatagcgaaaaacatcattatgttgctcgttacgggggtgaggaa
ctggccattatcatgcccgacacttcattgtccgtagctcaggatattgctgaaaaaatc
agaacgtcattacaaaacagcagactaaaacgcaaaaacagcaacgaatcgatcggcacc
attacgttatcgatcggtatcgcgactcgaaaacaaaacgatacgattgaaagctttatc
ttacgcgccgatcaggccctatataaagccaaagaaaccgggcgtaacaaagttatctgc
gaatgggccatggacgcaatcagccattgttaa

DBGET integrated database retrieval system