KEGG   Methylomicrobium alcaliphilum: MEALZ_2256Help
Entry
MEALZ_2256        CDS       T01649                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mah  Methylomicrobium alcaliphilum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2574767..2576170
Genome map
AA seq 467 aa AA seqDB search
MKKVQWFIILVVAVILFLPLSNLIGLSGENEPIEVIAGKSEAFAKASRVLQNKCVDCHSP
GMTRMPIYAGLPIAKQLMEHDIEEASERLLLTKEAYNGKEPLSPLMLARLEGVIRNNSMP
PALYLLMHWNGKLNHDEKTTLITWIAEERVKHPWSRDAANQFKGEPVQPLPLTVDLNPEI
VALGDKLFHDRRLSGDDTLNCASCHDLTRGGTDQTKVAIGISGQLGPINSPTVYVAMYNL
AQFWDGRAKDLQEQAAGPVTNPIEMGMVWDEVVEKLKQDEAYQQAFAKLYPDQGLTKTTV
TNAIAVFEESLVTPNSRFDQYLRGNVTVLTNEEKAGYELFKTHCASCHSGPALGGLSYEK
MGVARDYFKQRGGELTEADNGRFNVTKQEKDRHFFKVPVLRNIELTFPYFHDGSAETLAD
AVRVMGQVQLDKDFSGDEIGDMVAFLKTLTGEYKGKPLGELTAGDIR
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtccaatggttcatcatcttagttgtggcggtcattctgtttctgccgctt
tcgaacctgatcggtctgtccggtgaaaacgagccgatcgaagtaattgccggtaaatcg
gaggcttttgcgaaagcttcgcgggttttgcagaacaaatgcgtcgactgtcattcacca
ggcatgacccgcatgccgatctacgctggcctaccgatcgcaaaacaactgatggagcac
gacatcgaagaggccagcgaacgattgttgctgacgaaagaagcctataacggcaaggaa
cccttgtcgccgttgatgttggcccggctagaaggcgttatccgcaacaatagcatgccg
ccggcgctataccttctgatgcattggaacggcaagttgaaccatgacgaaaaaacgaca
ctaataacctggatcgcagaagagcgcgtcaaacatccatggagcagggacgccgccaat
caattcaagggcgaaccggtgcaaccgctgccgcttaccgtcgatctcaatcctgaaatt
gtcgcactcggcgacaaactgtttcacgaccgccgactgtccggtgacgacacgttaaat
tgcgcatcttgccacgatttgacgcgcggcggcaccgatcagaccaaagtcgcgatcggc
attagcggccaattgggaccgatcaactcgccaaccgtctatgttgcgatgtataacctt
gcgcaattctgggacggacgagcaaaagaccttcaggaacaagcggcgggaccggtgacg
aacccgatcgaaatgggtatggtatgggatgaagtcgtcgaaaaactcaaacaagacgaa
gcctatcaacaagccttcgccaagctgtatccggaccaaggcttgaccaaaacgaccgtc
acgaatgcaatcgccgtcttcgaggaatcgctggttacgccgaactcccgcttcgatcaa
taccttcgcggcaacgtgaccgtactgacgaacgaagaaaaagccggctacgagctgttc
aagacgcattgcgcgtcctgccattccggcccggcgctcggcggcttgtcgtatgaaaaa
atgggagtcgcgcgcgattacttcaaacaacgcggcggcgagttgacagaagcagacaac
ggccgattcaacgtcacgaaacaagaaaaagaccgtcatttcttcaaagtgccggtgctg
cgcaatatcgaattgactttcccttacttccacgacggctccgccgaaacgcttgccgac
gcggttcgcgtgatgggccaagtgcaactcgacaaagacttcagtggcgatgaaatcggc
gatatggttgctttcctgaaaacgctcactggcgaatacaaaggcaagccgcttggcgaa
ttgactgctggggacattcgttaa

DBGET integrated database retrieval system