KEGG   Methylomicrobium alcaliphilum: MEALZ_2681Help
Entry
MEALZ_2681        CDS       T01649                                 

Definition
(GenBank) Succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mah  Methylomicrobium alcaliphilum
Pathway
mah00020  Citrate cycle (TCA cycle)
mah00190  Oxidative phosphorylation
mah00650  Butanoate metabolism
mah01100  Metabolic pathways
mah01110  Biosynthesis of secondary metabolites
mah01120  Microbial metabolism in diverse environments
mah01130  Biosynthesis of antibiotics
mah01200  Carbon metabolism
Module
mah_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mah_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mah_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MEALZ_2681
   00650 Butanoate metabolism
    MEALZ_2681
  Energy metabolism
   00190 Oxidative phosphorylation
    MEALZ_2681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CCE24356
UniProt: G4SYQ9
Position
complement(3075625..3076005)
Genome map
AA seq 126 aa AA seqDB search
MDYRSPISKARGLGSAKSGTEHWWMQRVTAAALIPLSYWLIMLLKLATTATYQETIAWLS
APLNAVVIALWILAVCFHAALGVQVVIEDYVSAEGAKIIAVWTCHLLFTAIAVAALFAVL
QISLAG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggactatcgatctccgatttcgaaagcgcgcggtttgggttcggcaaaatccggaacc
gaacattggtggatgcagcgcgttaccgccgcggctttaatccctttgtcgtattggttg
atcatgttgcttaagctggctaccacagcgacctatcaggaaacgattgcctggttgtcg
gcgccgcttaatgcggttgttatcgcgctatggattttagcggtatgcttccatgcggca
ttgggcgtgcaagtggtcatcgaggattatgtttccgccgaaggcgctaaaatcattgcg
gtctggacgtgccatttactgtttacggcaatcgctgtcgcggcattgttcgctgtttta
caaatatctctagcaggctaa

DBGET integrated database retrieval system