KEGG   Methylomicrobium alcaliphilum: MEALZ_2681Help
Entry
MEALZ_2681        CDS       T01649                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MEALZ_2681
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MEALZ_2681
   00650 Butanoate metabolism
    MEALZ_2681
  Energy metabolism
   00190 Oxidative phosphorylation
    MEALZ_2681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3075625..3076005)
Genome map
AA seq 126 aa AA seqDB search
MDYRSPISKARGLGSAKSGTEHWWMQRVTAAALIPLSYWLIMLLKLATTATYQETIAWLS
APLNAVVIALWILAVCFHAALGVQVVIEDYVSAEGAKIIAVWTCHLLFTAIAVAALFAVL
QISLAG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggactatcgatctccgatttcgaaagcgcgcggtttgggttcggcaaaatccggaacc
gaacattggtggatgcagcgcgttaccgccgcggctttaatccctttgtcgtattggttg
atcatgttgcttaagctggctaccacagcgacctatcaggaaacgattgcctggttgtcg
gcgccgcttaatgcggttgttatcgcgctatggattttagcggtatgcttccatgcggca
ttgggcgtgcaagtggtcatcgaggattatgtttccgccgaaggcgctaaaatcattgcg
gtctggacgtgccatttactgtttacggcaatcgctgtcgcggcattgttcgctgtttta
caaatatctctagcaggctaa

DBGET integrated database retrieval system