KEGG   Methylomicrobium alcaliphilum: MEALZ_2754Help
Entry
MEALZ_2754        CDS       T01649                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mah00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mah00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mah00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mah00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3155698..3156579)
Genome map
AA seq 293 aa AA seqDB search
MKQIITKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVDEAVAAGIDTMIFVIGR
NKTSIVDHFDKAYELETELEAKGKIQTLRMIQNIVPPHVSCVYIRQSEALGLGHAVYCAR
PIVGDEPFAVILADDLIEDKHRGCMRQMVSVFNQERSSVLGVERVDPSETGSYGIVKTEP
VSEKLSDVKLIVEKPKPEEAPSNLAVVGRYILTPAIFDKIKRTKKGAGGEIQLTDAIAAL
MADEQVLAYEFEGQRYDCGSKLGFLIATVEHGLLHEELKNDFADYLKNLAARI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaattatcacgaaagccgtatttccggtcgcgggtttaggcacccggttttta
ccggccaccaaagctagtccgaaagaaatgttgccggtcgtcgataaaccgttgattcaa
tatgcagtcgacgaggcagtcgccgcaggaatcgatacgatgatctttgtgattggccgg
aacaaaacatcgattgtcgatcatttcgacaaagcctacgagcttgaaaccgagctggaa
gcgaaaggcaagattcaaactttacggatgatacaaaatatcgtaccgccgcatgtctcc
tgcgtttatattcggcagtccgaagcactggggttgggacatgcggtttactgcgcgcgg
cctatcgtcggcgacgaaccgtttgcggttattttagccgacgatttaatcgaagacaaa
caccgtggatgtatgcgacaaatggttagcgtattcaatcaggaacgcagtagcgtttta
ggagtcgagcgagtcgatccgtcggaaaccggtagttacggcatcgttaagaccgaaccg
gtctcggagaaattaagcgatgtgaaattgattgttgaaaaacctaagccggaggaagcg
ccgtcgaatttagcggtggttggccgctatattttgacgccggcgattttcgataaaatc
aaacggaccaaaaaaggcgccggcggagaaatacagctcaccgatgcgatcgccgcattg
atggccgacgaacaggttttggcgtatgagtttgaagggcagcgctacgattgcggttcc
aagctcggctttttaatcgcgacggtcgagcatggcttattgcatgaagagttgaaaaac
gattttgccgattatctgaaaaatctcgcggctcggatttaa

DBGET integrated database retrieval system