KEGG   Methylomicrobium alcaliphilum: MEALZ_2852Help
Entry
MEALZ_2852        CDS       T01649                                 

Gene name
xfp
Definition
D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MEALZ_2852 (xfp)
Enzymes [BR:mah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     MEALZ_2852 (xfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3268112..3270502
Genome map
AA seq 796 aa AA seqDB search
MSTDESLSISGPLDAEELRKIDAWWRACNYLSVGMIYLRANPLLKEPLSTEHVKHRLLGH
WGASPALSFAWAHLNRLIKRDELDVIFIAGPGHGAPGVLGPSYLEGTYSEVYPDKSEDTE
GMRKFFKQFSFPGQIGSHVTPETPGSIHEGGELGYSLAHAYGAAFDNPDLIVACVVGDGE
AETGPLATAWHSNKFLNPIRDGAVLPILNLNGYKIANPTILARISHEELEAMFIGYGYRP
YFVEGSDPAEMHQKMASVVDEAIAEIKTIQKSARESGIAERPRWPMIVLRSPKGWTGPKT
INGHQSEGSWRSHQVPFADAGTSSSGLRLLEEWLQSYRPEELFDDNGRLAEELRELSPQG
QRRMSANLHANGGLLRKALKLPDFRDYAVEVNRLGQAEHENTKPLGEFLRDVLKNNMTNF
RIFGPDETASNRLQAVYGASKKTWMADFLPEDEDGGELSRDGRVMEMLSEHTLVGWLEGY
LLTGRHGFFHTYEAFAHVVDSMFNQHAKWLDTSKNHVPWRAKVSSQNILLSSTVWRQDHN
GFSHQDPGFIDLVTNKSPSVTRVYLPPDANTLLSVADHCLRSTDYINVIVADKQKHLQFL
TIEEAIVHCTKGVGLWERASNDQGQDPDVVMACCGDVATLEALAATAILREHLPDLKVRF
VNVVDLFKLQPNTEHPHGLSHREFDSLFTVDKPVIFNFHGYPWLIHKLAYRFKNHENLHV
RGYKERGNINTPMELAILNEVDRFNLVIDVIDRVPKLQIRAAHLKELMKNEIIENLRYAH
QHGTDKPEITGWQWPF
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgatgaatcattatctatttccggtcctctcgatgccgaagaattaagaaaa
atcgatgcttggtggcgcgcctgcaattatttgtcggtcggcatgatttatctccgagct
aatcctctcctgaaagaacccttgtcgaccgaacatgtcaaacatcgtttattaggccac
tggggagccagtcccgctttgtcgtttgcctgggcgcatctcaatcgtttgattaaacgt
gacgagctcgatgtgatttttatcgccggtcccggtcatggagcccccggcgttttaggg
ccgagttacttggaaggcacctattccgaagtctatcccgataaaagcgaagacacggaa
ggcatgcgtaaattcttcaaacaattttcattcccgggccagatcggctcgcatgtcacg
ccggaaacgcccggttcgatccatgaaggcggcgaattgggctacagtctcgcacatgcc
tacggcgcagcattcgacaatccggacttgattgtcgcgtgcgtggtcggcgacggcgaa
gcggaaacgggaccattggcgactgcttggcattcgaataaattcttgaatccgatacgc
gacggcgcggtcttgcccattctcaatctgaatggctacaaaatcgccaatccgacaatt
cttgcccgcatcagtcacgaagaactggaggccatgtttatcggttatggttaccggccc
tatttcgtcgaaggcagcgatccggccgaaatgcatcaaaaaatggcttccgttgttgat
gaagccatcgccgaaatcaaaaccattcaaaagtccgcccgagaaagcggaatcgcagag
cgcccgcgctggccgatgatcgtgttacggtctccgaaaggctggaccggaccgaaaaca
atcaacggccatcaatccgaaggctcgtggcgatctcatcaagtgccctttgccgacgct
ggcaccagttcgtccggcttgcgcttactggaggaatggctgcaaagctatcgaccggaa
gagctattcgacgacaacggccgcctagcggaagaactcagagaactttctccacaaggc
cagcgccgaatgagcgccaatcttcacgccaacggcggcttattgcgcaaggcgctcaaa
ttacccgattttcgagactatgcggtcgaagtcaaccggctcggccaagccgaacatgaa
aacaccaagccgctgggcgaatttttacgggacgttctaaagaacaacatgacaaatttc
cggattttcggtccggacgaaaccgcatcgaaccgcttgcaagcggtctatggagcgtcc
aaaaagacctggatggcggattttttacccgaagacgaagacggcggcgaattgagccgg
gacgggcgcgtcatggaaatgctctccgaacataccctggtcggctggctcgaaggctac
ttgctgaccggccggcacggcttttttcatacctacgaagccttcgcccacgtcgtcgat
tcgatgttcaaccaacatgcaaaatggctcgacactagtaaaaaccatgtgccatggcga
gcgaaagtatcttcgcaaaatatcttgttgtcctcgaccgtctggcgtcaggatcataac
ggcttctcgcaccaagaccccggctttatcgatctggtcacgaacaaaagcccatcggtg
acccgcgtctatttgccgcccgatgcgaacaccctgctttcggttgccgatcattgcctg
cgttcgaccgactatatcaacgtcatagtcgcggacaagcaaaaacatcttcagtttttg
acgatcgaagaagcgattgtgcattgcaccaagggtgtcggactttgggaacgcgccagt
aacgaccaaggtcaagacccggacgtagtcatggcttgctgcggcgatgtcgcaaccttg
gaagcgctggccgcaacggccattctgcgtgagcatctaccggatttgaaagtccgtttt
gtcaatgtggtcgatttattcaaactgcaaccgaacaccgaacatcctcacggtttaagt
catcgcgaattcgatagcctattcacggtcgacaaaccggtcattttcaatttccacggc
tatccctggttgattcacaaattggcctatcgcttcaagaatcatgaaaatctgcatgtg
cggggctataaagaacgcggcaatatcaatacacccatggagcttgcgattctgaacgaa
gtcgatcgcttcaatctagtcatcgatgtcatcgaccgggttccgaaattgcaaatcagg
gcggcccatctcaaggagctcatgaaaaacgaaatcatcgagaatcttcgttatgcgcat
caacacggcaccgataaacccgaaatcaccggttggcaatggccgttttaa

DBGET integrated database retrieval system