KEGG   Methylomicrobium alcaliphilum: MEALZ_2858Help
Entry
MEALZ_2858        CDS       T01649                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mah00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3275944..3277701
Genome map
AA seq 585 aa AA seqDB search
MAKSQSIIQEFPFWFTQRAESRLIFLYGEERTKDLMNRLLDRMQHFSVPKAQPLPEYWNE
QDVILITYGDNIRQTDAKPLATLYEFSLLHLKDCINSIHVLPYFPFSSDDGFAVIDYKTV
DPQLGDWRDIERIAQDFSLMTDLVINHVSRENLWFIDYLSHKKPACDYFIELPENTDVSS
VVRPRSTPVLVPAHTHQGVRYVWATFGEDQIDVNFANPDVLFEFIDILLLYIEKGSRFIR
LDAVAFLWKKLDTRCINLRETHEVVKLLRDIVDLIAPDTVLITETNVPNGENLSYFGNSD
EAHMVYQFTLPPLLLHALYQGNSDYLTRWAKDMPRPQKNCTYLNFIASHDGIGLRPAEGI
LPEQEVKVLVDAMHEYGGYVSTRTGLDGRPAPYEINIALFDALKGTSLGLDQWQIQRFIC
AHTIMISLQGIPAIYINSLIATANDYHGVEQSGKTRSINRHKWEYSELMDLLNNPHSPNA
IIFHEFKRLLSIRRRQAAFHPDSAQETLSASPALFSFWRTSPDHRQRILVVSNITPQRQT
MTLPNHPRPEGSGLWRDLIERTAINKNTAELILYPYQTAWLEALD
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaatctcaatccattattcaagaattccctttttggttcacgcaacgcgcggaa
tcacgactaatatttctttacggcgaagagcgtacgaaagacttaatgaaccgcttactc
gaccgtatgcagcatttttcggtcccgaaggcacaacctcttcccgaatattggaacgag
caggatgtcattctgatcacctacggcgataacatccggcaaaccgacgccaaaccctta
gcgacgctctacgaattttcattacttcatctaaaagattgcatcaatagcattcatgtt
ttgccttattttccgttcagctccgacgacggctttgcagtgatcgactacaaaacggtc
gatccgcaattaggcgactggcgcgacatcgagcgtattgcgcaagactttagcttaatg
accgacttggtgatcaatcatgtttcccgcgaaaatctttggtttatcgattatctgagt
cataaaaaaccggcctgcgattattttatcgaattgccggaaaataccgatgtaagttcg
gtcgtacgcccgcgcagcacgccggtactagtacccgcgcatacccaccaaggcgtacgc
tatgtttgggcgacattcggcgaagaccaaattgacgtcaacttcgctaatcccgacgtg
ctgttcgagtttatcgacattttactgctgtatatcgaaaaaggttctcgatttattcga
ctggatgcggtcgcatttctgtggaaaaaattggacacccgctgtatcaacttgcgcgaa
acgcacgaagtcgtcaaattattacgcgacattgtcgaccttattgcgcccgacacggtt
cttatcaccgaaaccaatgtaccgaacggcgaaaacctaagctatttcggcaacagcgac
gaagcacacatggtttatcaattcacgctaccgccgctattattgcatgctctgtaccag
ggtaactcggattacttgacccgttgggccaaggatatgccacgtccgcaaaaaaattgc
acctatttgaattttattgcatctcacgatggcattggcctgcgtccggcggaaggcata
ttgcctgagcaggaagtcaaggttttggtcgatgcgatgcacgaatacggcggttatgtc
agcacgcgcaccggtttggacgggcgtcccgcaccttacgaaatcaatatcgcgttgttc
gacgcccttaaaggtacgtctttgggcctcgatcaatggcagatccaacgatttatatgc
gcgcataccatcatgatatcgttgcaggggattccggccatttacatcaatagcctgatc
gcaaccgctaatgattatcatggcgtcgagcaatcgggcaaaacgcgatcgatcaaccga
cataaatgggaatatagcgaattgatggacttgttaaataaccctcatagcccaaatgcg
attatatttcatgaattcaaacggttactcagcattcgaagaaggcaagccgcctttcat
ccggactcggctcaggaaacgctaagcgccagcccagccttgttttcattttggcgcact
agcccggatcatcgccaacgcatcctggtcgtaagcaatattacgccgcaacgacaaacc
atgacattgcctaatcatccccgccccgaagggtcgggattgtggcgagatttgatcgag
cgcaccgccatcaacaaaaacactgccgagttgattttgtatccttaccaaaccgcctgg
ctcgaagccttggattag

DBGET integrated database retrieval system