KEGG   Methylomicrobium alcaliphilum: MEALZ_3130Help
Entry
MEALZ_3130        CDS       T01649                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mah00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3635962..3637497)
Genome map
AA seq 511 aa AA seqDB search
MSNDTLQIRRIGIDTYHENVAYLNRECAFYRAEGFQALSKIKVCANGNKLLAVLNVVDDS
SIVHSGELGLSEQAFQKLNIDEGALVTVEHAEPPASMDAVRRKINGERLSQDDFTSIAKD
IAETRYSKMEMAAFLVATGQNNLDRDELLYLTRAMLDSGERMNWHESLVADKHCIGGIPG
NRTSMLVVPIVAAHGMLIPKTSSRAITSPAGTADTMEVLAEVNLSPERLHDIVRQERGCL
AWGGTAKLAPVDDLLISVERPLGIDSQGQMVASILSKKLAAGSTHLIVDIPVGPTAKVRH
MRQALALRKLFEFVGDQLNIHLEVMITDGRQPVGRGIGPVLEARDIMQVLENNPDAPFDL
RQKSLQLAGRIIEFDPDVRGGQGYAIARDILDSGRAIAKMNDLIQAQGAKTIDFTPGILC
HEVCADKEGIVTHIDNFQMAKIARIAGAPMDKKAGVDLLKKIGDRVQKGEPIYRVYAGFS
ADFKFAKTLAVDDNGYRIGVEEHVLKPLVAF
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgacacgttacaaattcgtcgtatcggtatcgatacgtatcatgaaaacgtt
gcctatttaaaccgggaatgcgcattttaccgagccgaggggtttcaggcgttgtcgaaa
atcaaggtttgcgcgaacggcaataagctgttggcagtgctcaatgtcgtggacgatagc
tccatcgtgcattcgggcgaactgggtctttccgagcaagctttccaaaaactcaatatt
gacgaaggcgcattagttacggtggagcatgccgaaccgcccgcgtcgatggatgccgtg
cgccgaaagattaacggcgaacgcttgagccaagatgatttcactagtattgccaaggat
attgccgagacacgctattcgaaaatggaaatggcggcttttttggtcgcgaccggtcaa
aataatctcgaccgagacgagctcttgtatttgacgcgcgcgatgttggattcgggcgag
cgcatgaattggcacgaatcgctggtggccgacaagcattgtatcggcggcataccgggt
aatcgaacttcgatgttggtcgtgcctatcgtcgccgcgcacgggatgttgatcccgaaa
acgtcgagtcgggcgattacgtcgccggccggtaccgccgatacgatggaagttttagcc
gaagtcaatttatctccagagcgtttacacgatattgtgcgccaggaacgcggctgtcta
gcatggggcggtaccgcgaagctggcgccggtcgacgatttgttaatttcggtcgagcgc
ccgctcgggatcgattctcaagggcagatggtggcctcgattctgtcgaaaaaattggcg
gcgggttccacgcatttgattgtcgatattccggtcgggccgaccgcaaaagttcggcac
atgcgccaagcgcttgctttacgcaagttattcgagtttgtcggcgatcagctcaatatt
cacttggaagtcatgattaccgatggtcgccaaccggttggtcgcggcatcgggccggta
ctcgaggcacgcgatatcatgcaggtgttggaaaacaatcccgatgcgccattcgatttg
cgccaaaaatcgctgcaattagccggaagaattattgaattcgatcccgatgttagaggc
gggcagggctatgcgattgcgcgggatattctcgattcgggccgggcaattgccaaaatg
aacgatttgatacaggctcaaggcgccaaaactatagactttacgcctggtattttatgt
catgaggtttgcgcggataaggagggtatcgtgacccatatcgataattttcaaatggcc
aagattgcccgaattgccggtgcgccgatggataagaaagccggcgtcgatctgttgaaa
aaaatcggcgacagggtgcagaaaggcgagccgatttatcgtgtttacgccggcttttcg
gcggattttaaattcgcgaaaacgttagcggtcgatgataacggttatcgtatcggcgta
gaggagcatgttttgaagccgttggtggctttctaa

DBGET integrated database retrieval system