KEGG   Methylomicrobium alcaliphilum: MEALZ_3137Help
Entry
MEALZ_3137        CDS       T01649                                 

Gene name
cheB
Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mah02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mah02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3642537..3643643
Genome map
AA seq 368 aa AA seqDB search
MNIIKVFIVDDSAVVRQVLTQLFDSTAGIKVIGSAPDPIFALQKMEKEWPDVIVLDIEMP
RMDGVTFLKKIMHEHPTPVVICSTLTEKGAEVTMQAMSAGAVDIITKPKVNLRHFLEESN
TLIIDAVKAAAHARVGKIKSMPSSTEPKPKQNADAVIAPSHLKPLSETTDRVIAIGTSTG
GTQALEFVLTKLPRTTPGLVVVQHMPEAFTAAFAKRLDGLCQVSVKEAETNDRVIPGQVL
IAPGGKHMLLRRSGAQYRVEVKDGPLVSRHRPSVDVLFRSCAQSAGPNAVGIIMTGMGDD
GAKGMKEMFDAGAFTVAQDEASCIVYGMPKEAVKLGGVSKTLPLNSIPELIVNSSTGTPL
SRASNTAE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcatcaaagttttcatcgtagacgactcggcagtcgttagacaggttctcaca
caattgttcgacagtactgccggcatcaaagttatcggatcggcgcccgatccgattttt
gccctgcaaaaaatggaaaaagagtggccggacgtaatcgtattggatatcgaaatgccg
cgtatggacggcgtaacctttctcaagaaaatcatgcacgaacacccgactccggtcgtc
atttgctcgacgctaaccgaaaaaggcgctgaagtgacgatgcaggcaatgagtgccgga
gcggtcgacatcatcactaagcccaaggtcaacctacgccacttccttgaggaatccaac
acgctgattatcgatgccgtgaaagccgcagctcatgcccgagtcggtaaaataaaaagc
atgccgtcaagcaccgagcccaaaccgaaacaaaatgccgatgcggtcatcgccccttcg
catttaaaacctctgtcggaaacgaccgacagggtaattgccataggcacttcgacaggc
ggaactcaagccttggagtttgtattgaccaaactccctagaaccacgccgggactggtg
gttgtgcagcatatgcccgaggcatttaccgctgccttcgccaagcggcttgacggcctt
tgccaagtctccgtcaaggaagccgaaaccaacgaccgggtcatccccggacaggttttg
atcgctccgggaggcaaacacatgctgctgcgccgaagcggcgcgcaatatcgcgtcgaa
gtcaaagacgggccattggtcagccggcaccggccgtccgtggacgttttatttcgctcc
tgcgctcaatcggccggcccgaacgccgtcggtatcatcatgaccggcatgggcgacgac
ggcgcgaaaggcatgaaagaaatgttcgatgccggcgcgttcaccgtcgcacaagacgaa
gcttcatgcatcgtttacggcatgcccaaggaagcggtgaaactcggcggcgtctccaaa
actttgcctttaaattcgatacctgaacttatcgtcaactcgtcaaccggaacgccttta
agcagagcttcgaatacggcagaatga

DBGET integrated database retrieval system