KEGG   Methylomicrobium alcaliphilum: MEALZ_3370Help
Entry
MEALZ_3370        CDS       T01649                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase)
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
mah00900  Terpenoid backbone biosynthesis
mah01100  Metabolic pathways
mah01110  Biosynthesis of secondary metabolites
mah01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MEALZ_3370 (ispE)
Enzymes [BR:mah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     MEALZ_3370 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C DUF4581
Motif
Other DBs
NCBI-ProteinID: CCE25033
UniProt: G4SU84
Position
complement(3883548..3884396)
Genome map
AA seq 282 aa AA seqDB search
MSEVYKRWPAPAKLNLMLRIVGQREDGYHLLQTVFQFIDLCDWLVFRPVNDSVISLRNPL
PGVPEADDLTFRAAQLLKEETGYEGGVVIEIEKHLPMGGGLGGGSSDAATTLVALNNLWR
LGLSRERLMQLGLRLGADVPIFVFGHSAWAEGVGEVFQKIEVPEKWIVVLKPDCHVDTKE
IFSSKDLTRDSKSIKIADFIAGQHQNDCLGVVRKLYPSVDRALRELSIFSEARLTGTGAC
VFAQFDTELAAKKAYLPLSKKWQSYLCKGINRSPLYSSLNGA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggtgtataagagatggccagcgccggcaaaattgaatttaatgttgagaata
gtggggcaaagggaagatgggtatcacttgctacaaacagtattccaattcattgatttg
tgcgattggttggtgtttcgcccagtaaatgattcggtgatttctttgcgtaatccgctc
cccggggttcctgaggctgatgatttaacttttagggctgctcagttgctaaaagaagaa
accggttatgagggtggggttgtcatcgagattgaaaaacacttgcctatgggaggcggt
ttaggtggggggagttccgatgcggcaacgacattggtagcgcttaataatttgtggcgg
ttagggctttcccgtgagcggctgatgcagttaggcttgcggctgggcgcggacgtgccg
atttttgttttcggtcatagtgcctgggcggaaggcgttggcgaggtgtttcagaagatt
gaggtgccggaaaaatggatcgtagtgctgaagccggattgtcatgtcgataccaaggaa
attttttcatcaaaagatttgacaagggatagtaaatcaatcaaaatagccgactttatt
gcagggcagcaccaaaacgattgtttaggcgttgttcggaagctttacccgtctgttgat
agggctttgagagaattgtcgatattttccgaagcaaggttgacaggtacaggagcatgc
gtttttgctcagtttgatacagagttggcagctaaaaaagcgtatttgccgcttagcaaa
aagtggcaatcttatctgtgtaagggaataaacaggtctccgttgtactcaagtctgaat
ggtgcttaa

DBGET integrated database retrieval system