KEGG   Methylomicrobium alcaliphilum: MEALZ_3507Help
Entry
MEALZ_3507        CDS       T01649                                 

Gene name
glgB1
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
mah00500  Starch and sucrose metabolism
mah01100  Metabolic pathways
mah01110  Biosynthesis of secondary metabolites
Module
mah_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MEALZ_3507 (glgB1)
Enzymes [BR:mah01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MEALZ_3507 (glgB1)
Exosome [BR:mah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MEALZ_3507 (glgB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: CCE25169
UniProt: G4SVT4
Position
4043198..4045384
Genome map
AA seq 728 aa AA seqDB search
MPLCNDLCKIIEAKHHDPFSVLGRLSDNNLTKVRLYLPYADSVRFAEKGPEIPRLAKTDF
FEYTAQAGELPEHYQISWIDKEGRQHTDYDPYDFPEQLPEFDRHLFGEGKHWHIYQKLGA
HRYKVDGIDGVLFTVWAPSAERVSVVGDFNRWDGRCHLMRVLGNSGVWELFIPGLDAGCL
YKFEILNRQSQEILIKTDPYAQQYEHRPKTASIVVKEGAYQWQDAKWMTYRKTRDWLHEP
MSIYEVHLGSWQRDDAGNFLNYRELAKQLIQYVKDMGFTHIELLPITEHPFDASWGYQST
GYFAPTSRHGSPDDFRYFIDLFHQNNIGIILDWVPAHFPKDFFALARFDGSALYEHEDPR
KGEHRDWGTLIFNFGRNEVKNFLLASAIFWLEEFHLDGLRVDAVASMLYLDYSRDENDWI
PNMYGGNENLEAIAFLRELNTVTHEQHPGTVVMAEESTAWPQVTRPTWTGGLGFSIKWNM
GWMHDILDYISRDPIHRRYHHDQLTFGLLYAFTENFVLPFSHDEVIHGKGSLLNRMPGDE
WRKFANLRLLYTLMFTYPGKKLLFMGCEFGQGTEWNFNQPLDWYVLQYPQHQGLQTLVKD
LNHLYKNYPALHQYDFNHSGFDWIDCHDVEQSIISYRRKGTNDDLIIILNFTPIVRENYH
IGVPSEGVYFEIFNSDSAYYEGSNIGNREILSEPEPWMGHQQSIHLTLPPLGGIILTRQT
KAISSSAH
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgtgtaatgatttatgcaaaatcattgaagccaaacatcatgaccctttttcc
gttctaggccgcctcagcgataacaacctgaccaaggtaagactctatttgccttacgcc
gattcggttcgttttgctgaaaaaggccctgaaatacctcgactcgcaaaaacggacttt
tttgaatataccgctcaggccggcgaattaccagaacattatcaaatttcttggatcgac
aaggaaggccgacaacacaccgattacgacccttatgactttcccgagcaattgccggaa
ttcgatcgtcatttgttcggcgaaggcaaacattggcatatctaccaaaaacttggcgca
catcgatataaggtcgacggcatcgatggcgtattatttaccgtctgggccccaagcgcg
gagcgcgtcagcgtggtcggcgattttaaccgctgggacgggcgctgtcacttaatgcga
gtgctaggtaacagcggggtctgggagctttttattccgggcctcgacgcgggctgttta
tataaattcgaaatactgaaccgtcaaagccaagaaattttgattaaaacagacccttat
gcccagcaatatgagcatcgccctaaaaccgcttcgattgtcgtcaaagaaggagcctat
caatggcaagatgcgaaatggatgacttatcgcaaaacccgcgattggcttcacgaaccg
atgtctatttacgaagtgcatttaggctcgtggcaacgggacgatgccggaaatttcttg
aattaccgtgaactcgctaaacagttaatccaatacgtcaaagacatgggctttacccat
atcgaattactgcctatcaccgagcatcctttcgatgcttcatggggttaccaatcgacg
ggctacttcgccccgaccagtcgacacggatcacccgacgatttcagatattttatcgat
ctctttcatcaaaacaacatcggcattattttggactgggttcccgcgcattttccgaag
gactttttcgcactggcgcgattcgacggtagcgcgctctatgagcacgaagacccccgc
aaaggcgagcatagagattggggcaccctgatctttaacttcgggcgcaacgaagtcaaa
aatttcttactggcgagcgcgatattttggctcgaagaatttcaccttgacggtcttagg
gtcgacgccgtcgcatcgatgctttatctggattattcccgcgatgaaaacgactggatt
cccaacatgtatggcggcaacgaaaatctcgaagccatcgcttttttgcgcgaactcaat
accgtaacgcatgaacaacaccccggcacggtcgtgatggcagaggaatcgaccgcatgg
cctcaggtaacccgcccgacttggaccggaggcctgggtttttcgataaaatggaacatg
ggctggatgcatgacattctcgattatataagccgcgacccgatacacaggcgttatcac
cacgatcaactaaccttcggcctactttatgcctttaccgagaacttcgtccttccgttc
tctcatgatgaagtcattcacggcaaaggttcgttactcaacagaatgccgggagacgaa
tggcgaaaatttgcgaatttacgcctactttataccttgatgtttacctacccgggtaaa
aaattattattcatgggttgcgagttcgggcaaggtacagagtggaatttcaaccaaccc
ctggattggtatgtactgcagtatcctcaacaccaaggtttgcaaactttggtcaaagat
cttaatcatttgtataaaaactacccggcacttcaccaatacgacttcaatcacagcggc
tttgactggatcgattgccatgatgtcgaacaatcgattattagctaccgccgcaaaggc
accaacgatgatttgatcatcatacttaacttcacaccgattgtgagagaaaactatcat
atcggcgtgccttccgaaggggtttattttgaaatctttaattcagactctgcctattat
gaaggtagcaacatcggcaaccgcgagatactatcggaaccggagccttggatgggacac
caacaatcgatacacttgactttacctccgctaggcggaatcatcttgacgaggcaaacg
aaagccataagcagctctgctcactaa

DBGET integrated database retrieval system