KEGG   Methylomicrobium alcaliphilum: MEALZ_3729Help
Entry
MEALZ_3729        CDS       T01649                                 

Gene name
tesA
Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MEALZ_3729 (tesA)
Enzymes [BR:mah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MEALZ_3729 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     MEALZ_3729 (tesA)
Lipid biosynthesis proteins [BR:mah01004]
 Fatty acid synthase
  Component type
   MEALZ_3729 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4306004..4306558)
Genome map
AA seq 184 aa AA seqDB search
MSAETIVVLGDSISAGYGIEAGKGWVDLLQKKLEAEKFPHQVVNESISGDTSAGGLARID
SALARHSPEWVLLELGGNDGLRGLTPKQMHDNLNEIVKRSKQAGAQVLLLGMRMPPNLGK
RYIEIFYQVYPELAKEHDLPFVPFILEDVALKAELMQRDRIHPNADAQPIIAEKVWEYLG
PLLK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggctgaaacgattgtcgtattaggcgatagtatcagcgccggatacggaatagaa
gcggggaaaggctgggtcgatttacttcagaaaaagctggaggccgaaaagttcccgcat
caggtggttaacgaaagcatcagcggcgataccagcgccggcggattggcgcgcatcgac
agcgcgttggcgcggcatagcccggaatgggtgctgctggagcttggcggcaacgacggt
ttaagaggattgacccccaagcaaatgcacgacaacttgaatgaaatcgtcaagcgttcg
aaacaggccggtgcgcaagttttgctgctaggcatgcgcatgccgccgaatctcggtaaa
cgctatattgaaattttttaccaggtttatccggaactggccaaagaacacgacctgcct
ttcgtgccttttatactcgaagacgtggccctgaaagcagaactgatgcagcgcgaccga
attcatccgaatgccgacgcacaaccgattatcgccgaaaaagtatgggaatatttaggt
ccgctgttaaaatga

DBGET integrated database retrieval system