KEGG   Methylomicrobium alcaliphilum: MEALZ_3832Help
Entry
MEALZ_3832        CDS       T01649                                 

Gene name
dfrA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mah00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mah00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4419305..4419772
Genome map
AA seq 155 aa AA seqDB search
MSSNRAIGIDNRLPWHLSADLKKFKSITMGSPILMGRKTYESIGRPLPGRINIVITRNPD
YRPSGCEVYNDIESAMESCRNHNEIFVIGGATFYEAMLPVADYLYLTEVRRAFEGDTFFP
EIDNNHWLETHREDIHDDPDVSFGYSFVKLERIKK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtaatcgcgcgatcggtatcgataaccgcttgccgtggcatttatccgcggac
ctgaaaaaattcaaatccatcacgatgggatcgccgatattgatgggccgtaaaacgtac
gagtcgatcggcaggccgttgccgggacggatcaatatcgttattacgcgtaatcccgat
taccgtccttcgggctgcgaggtatataacgatatcgaaagcgcgatggaaagttgccgt
aatcataacgaaattttcgtgatcggcggagcgacattttacgaggccatgctgccggtt
gccgattacctatacctaaccgaggttaggcgtgcgttcgaaggcgatactttttttccg
gaaatcgacaataatcattggttggaaacgcatcgtgaggatattcacgacgacccggac
gtttccttcgggtacagttttgtgaagctggaaagaataaaaaaatag

DBGET integrated database retrieval system