KEGG   Micavibrio aeruginosavorus ARL-13: MICA_1023Help
Entry
MICA_1023         CDS       T01630                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MICA_1023
Enzymes [BR:mai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MICA_1023
Peptidases [BR:mai01002]
 Cysteine Peptidases
  Family C44
   MICA_1023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1021192..1023195
Genome map
AA seq 667 aa AA seqDB search
MCGISGFIASNTLPIDNLRDATNIIRHRGPDDEGFVFFSDKSDVPLVLSGPDTPVPVAEK
TPAWFPQEQYIENKAAARVGFGHRRLSILDLSPLGHQPMSYSNGRYWITYNGEVYNYLEI
RTELQALGHEFVSRTDTEVILAAYAQWGKECLSKFNGMWSFAIFDRDDNKIFLARDRFGV
KPLYYWLSPKNDFYFGSEIKQFTALPDWDAVVNKQRAYDFLVWGITDHTDETLFQGVFHI
RPGHYAEIKASDAVPHVSGRINTVKWYEISKTKFSVPMAQAAEEFHSLLKQSVGVRLRSD
VAVGSCLSGGLDSSSIVCLMQNILQENGANNAQKTFSALSDVEKFNEQRWIEAVVNHAQT
EAHYTHPKMDDLFDISRSITWHQDEPFGSTSIFAQWNVFKLAAEEDVRVMLDGQGADEQL
FGYHGAMGVRFGALFRSMRWVQLLREFVKVHNIHGYSYRTLIAQFAASVLPQPMQSILRK
MLGKTTSVPDWIDWNVLSAMRVSPFKGAEKSVYDYCYAQMTSTNLQMLLHWEDRDSMAHS
IESRVPFLDYRVVEFSMGIPDDYKTCNGVTKRILRAGMSGTIPNEIRDRMDKIGFATPEE
VWVREAAPDLFRQKMKEAIESSQGILNSNCMNILEDVIAGRKPFSFVIWRMINFGEWMKL
FSVRVAR
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatttcgggctttattgcttctaatactttgccgattgataatctgcgagac
gcaacaaatattatccgtcaccgcggccccgatgatgagggcttcgtgtttttttcagat
aaatcagatgtgcctttggttttatctggcccagatacgccagtgcctgttgctgaaaaa
acgcccgcgtggttcccgcaagaacaatacattgaaaataaagccgctgctcgcgttggc
tttggtcaccgccgtttgtccattctggatctttctccactaggtcatcagcccatgagt
tatagtaatgggcgatattggattacatacaatggggaagtttataattatttggaaatt
cggactgaactgcaagcgctagggcatgaatttgtatcccggacggatacggaagtcatt
ttggccgcgtatgcacaatggggtaaagagtgtctcagtaaatttaatgggatgtggtca
tttgcgatttttgatcgtgatgataataaaatttttcttgcacgtgaccgctttggtgta
aagccgctttattactggttgtcaccaaaaaacgatttttattttggatcagaaattaag
caatttacggctctgcctgattgggatgcggttgtaaataaacaacgcgcatatgatttt
cttgtttggggtataacagatcatacagatgagacattgtttcagggggtgtttcatatc
cgtccggggcattatgcagaaataaaagcttctgatgctgttcctcatgtaagtggacga
attaataccgttaagtggtatgaaatttccaaaaccaaattttctgtgcctatggcgcag
gcggcagaagaatttcatagcttgttaaagcaatctgtaggggtgcgtctccgttccgat
gtcgcggttgggtcgtgtctgtcaggtggattggattcatcatcaattgtttgtttgatg
caaaatatactgcaggaaaacggtgcgaataatgcgcaaaaaactttttctgctttgtcc
gatgttgaaaaatttaatgagcaaaggtggattgaggctgtggttaatcatgcgcaaacg
gaagcgcattacacgcaccccaagatggatgatttgttcgatatttcacgttctataacc
tggcatcaggatgagccatttgggtccacgagtattttcgcacaatggaatgtatttaaa
ttggctgcggaagaagatgtacgcgtcatgctagacgggcagggggctgacgagcaactt
tttggttaccatggtgccatgggcgtacgttttggagcattgttccgcagtatgcgttgg
gtgcagttattgcgtgagtttgtgaaggttcataatatacatggatattcatatagaacg
ctgattgcgcaattcgccgcttctgtgttgccgcaaccaatgcagtctatattaagaaaa
atgttgggaaaaacaacgtctgttcctgattggatcgattggaatgttttgtctgcgatg
agggtgtcgccgtttaagggggcagaaaagtcagtttacgattattgttatgctcagatg
acatcgacaaatttgcaaatgttgttgcattgggaagatcgcgattcaatggcgcattcg
attgaatcacgtgttcctttcctggactatcgtgttgttgagttttcgatgggtattcca
gatgattacaagacctgtaatggagtaacgaaacggattcttcgcgccggtatgagtggc
actataccgaatgaaatccgtgatcgtatggataaaattggatttgcaacgccagaagaa
gtctgggtgcgtgaagctgctcctgatttgttccgtcaaaaaatgaaagaagcgatagag
agctcacagggaattttgaattcaaactgcatgaatatactggaagatgttattgcgggg
cgcaagccattcagctttgtgatttggcgtatgattaattttggcgaatggatgaaattg
ttttctgttcgtgtggcgaggtag

DBGET integrated database retrieval system