KEGG   Micavibrio aeruginosavorus ARL-13: MICA_1156Help
Entry
MICA_1156         CDS       T01630                                 

Definition
protein-L-isoaspartate family protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1138231..1138890
Genome map
AA seq 219 aa AA seqDB search
MNFSQARSAMVESQIHTMGVVTPAILEAFRTVPRESFVPPHLAGIAYIDEDIPLGDGRVL
IEPAVLARMIEAAQVNANDVVLNVGDSTGYSSAVLSLLASTVVTMESHPGQLDAARHAWA
ACDYCNIAPITCDAMEGCPEHAPYSLIVMNGAVAEIPEIFVAQLSVNGRLAAVLKPDANA
PGHAVIVQRVGNEKYSTTKVFDASMPYLPGFEPRRDFVF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttctcaggcgcgcagcgcgatggttgaatcccagatccacacaatgggggtg
gtcacgcccgccattttggaggcgtttcggaccgttccgcgcgaatctttcgtgccgcct
catctggcgggtatcgcatatattgatgaagatattcctctgggcgatggccgcgtgttg
atcgaaccggctgttctggcgcgcatgattgaggccgcacaggtcaatgccaatgatgtt
gttttgaatgttggtgacagcacgggatattcgtccgcagtgttgtcgttgttggcctcc
accgtggtgacgatggaatcccacccgggtcaattggatgcggcgcgccatgcatgggcg
gcgtgtgattactgtaacattgcgccgattacatgcgacgcgatggaggggtgcccggaa
catgcgccgtattcattgattgtgatgaatggtgccgttgccgaaattcccgaaattttc
gttgcacaattgtccgtgaacgggcggttggctgctgttctgaaacccgatgccaatgcc
cccggccatgccgtgattgtacagcgcgtcggcaatgaaaaatattcgaccacgaaagtg
ttcgacgcgagtatgccgtatctgccggggtttgaaccgcggcgcgattttgttttctaa

DBGET integrated database retrieval system