KEGG   Micavibrio aeruginosavorus ARL-13: MICA_1180Help
Entry
MICA_1180         CDS       T01630                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mai00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MICA_1180 (ruvA)
Enzymes [BR:mai01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MICA_1180 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1159263..1159901
Genome map
AA seq 212 aa AA seqDB search
MIAKLSGILDSVALDCLIIDCGGVGYQVFASGRTLSRVGQPGDPVSVLIDTHVREDHIHL
FGFYDAAEQAWFRLLTSVQGVGAKVALAILSVCPPDKLGYTIAAQDVSALRQADGVGPKL
ATRIATELKDKAGKVDLTPMRGAVKAPSMKTDKPAADQSGVDGDAVSALVNLGYGRAEAF
AAIAQLRAAGTANDNSSLQDLIRLALKELSQS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcaaaactcagcggtattctggattctgttgcgctcgattgtttgattatcgat
tgtggcggcgtggggtatcaggtgttcgccagtggccgcacgttgtcccgcgtgggtcag
ccgggtgatccggtcagcgtgctgatcgacacgcatgtgcgcgaagaccatatccatctg
ttcggtttttatgatgcggcggaacaggcatggttccgtctgttgaccagtgtgcagggc
gtgggcgcgaaagtggcgttggcgatcctgagcgtatgtccgccggacaagctgggctac
accatcgccgcacaagacgttagcgcgttgcgtcaggctgatggcgttggcccgaaactg
gccacacgcattgcaacggaattgaaagataaagcaggcaaggttgatctgacccccatg
cgcggcgcggtcaaggctccttcgatgaagacggataaacccgccgccgatcaatccggt
gttgatggcgatgccgtgtcggcattggtcaatctcggctatggccgggctgaggccttt
gcggccattgcgcaattacgcgcggcgggaaccgcaaatgataatagcagcctgcaagat
ctcatccgtctggcgttgaaggagttgtcacaatcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system