KEGG   Micavibrio aeruginosavorus ARL-13: MICA_1292Help
Entry
MICA_1292         CDS       T01630                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mai00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1285650..1286384)
Genome map
AA seq 244 aa AA seqDB search
MTTRILDVVDMQFDFMKSNGGLYVPNAEPLIDRTNDFFRSIPRGIYDLALIKYDTHFPCE
YQNSPEKADFPDIHCPYGTQGWELVVNDAELAKRMPVYYMAKNTFDMWQQNPISDRGQMF
FDTDAEEQAYDNLYHVTRDRQVIQTGELRDEFMRRVVKLGTAENVEVTMIGVASDFCVHD
AMMGYLQRGANVRVVADLVAGIGTPVPGRAPKGTIGDVISLPVFQPYVQNKQLKIISLQD
ALKP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcgtattttggatgttgttgatatgcagttcgattttatgaagtcgaatggt
ggcctttatgttccgaatgccgagccgttgattgaccggaccaacgatttttttcggtcc
attccgcgcggtatttatgatctggcgttgatcaaatatgacacgcattttccgtgtgaa
tatcaaaacagcccggaaaaagctgattttccggacattcactgtccctatggcacacag
ggatgggaactggttgtgaatgatgccgagctggcaaagcggatgccggtttattacatg
gcaaaaaacacgttcgatatgtggcaacaaaacccaatttctgaccgcggtcagatgttc
tttgacacggatgcggaggaacaggcctatgacaacctgtatcacgttacccgtgatcgt
caggtgattcagacgggcgagttgcgcgatgagtttatgcgccgcgtggtcaagttggga
acagcagagaatgtcgaggtcaccatgatcggcgtggcgtctgatttctgtgttcatgat
gccatgatgggctatctgcaacgcggggccaatgtgcgtgttgtggccgatctggtcgcc
gggattggaacaccggtcccgggccgtgcgcccaagggaacaattggtgatgtgatcagc
ctgcctgtgttccagccctatgttcagaataaacagctgaaaatcatcagtcttcaggac
gcgttaaaaccgtaa

DBGET integrated database retrieval system