KEGG   Micavibrio aeruginosavorus ARL-13: MICA_1292Help
Entry
MICA_1292         CDS       T01630                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MICA_1292
Enzymes [BR:mai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     MICA_1292
    3.5.1.-  
     MICA_1292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1285650..1286384)
Genome map
AA seq 244 aa AA seqDB search
MTTRILDVVDMQFDFMKSNGGLYVPNAEPLIDRTNDFFRSIPRGIYDLALIKYDTHFPCE
YQNSPEKADFPDIHCPYGTQGWELVVNDAELAKRMPVYYMAKNTFDMWQQNPISDRGQMF
FDTDAEEQAYDNLYHVTRDRQVIQTGELRDEFMRRVVKLGTAENVEVTMIGVASDFCVHD
AMMGYLQRGANVRVVADLVAGIGTPVPGRAPKGTIGDVISLPVFQPYVQNKQLKIISLQD
ALKP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcgtattttggatgttgttgatatgcagttcgattttatgaagtcgaatggt
ggcctttatgttccgaatgccgagccgttgattgaccggaccaacgatttttttcggtcc
attccgcgcggtatttatgatctggcgttgatcaaatatgacacgcattttccgtgtgaa
tatcaaaacagcccggaaaaagctgattttccggacattcactgtccctatggcacacag
ggatgggaactggttgtgaatgatgccgagctggcaaagcggatgccggtttattacatg
gcaaaaaacacgttcgatatgtggcaacaaaacccaatttctgaccgcggtcagatgttc
tttgacacggatgcggaggaacaggcctatgacaacctgtatcacgttacccgtgatcgt
caggtgattcagacgggcgagttgcgcgatgagtttatgcgccgcgtggtcaagttggga
acagcagagaatgtcgaggtcaccatgatcggcgtggcgtctgatttctgtgttcatgat
gccatgatgggctatctgcaacgcggggccaatgtgcgtgttgtggccgatctggtcgcc
gggattggaacaccggtcccgggccgtgcgcccaagggaacaattggtgatgtgatcagc
ctgcctgtgttccagccctatgttcagaataaacagctgaaaatcatcagtcttcaggac
gcgttaaaaccgtaa

DBGET integrated database retrieval system