KEGG   Micavibrio aeruginosavorus ARL-13: MICA_1301Help
Entry
MICA_1301         CDS       T01630                                 

Definition
hypothetical protein
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MICA_1301
   00240 Pyrimidine metabolism
    MICA_1301
Enzymes [BR:mai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     MICA_1301
    2.7.1.76  2'-deoxyadenosine kinase
     MICA_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1294089..1294694)
Genome map
AA seq 201 aa AA seqDB search
MGRRIEMSGILAAGKSTLCDIFARNGFTIGRENVQDNPYWAKVQVDPKTYEPLLQEWILK
QRFNEVARSESAGATPLQMIDFCLAVDKAYADFYMAESAPEKMRKTHDAIDNMYATYGDP
ALIVHLHCDSTELIRRIEKRGRFFEQSHTVEFLDSLNGKICHYLDRVKSKGTIPVLEFDM
THGGPKIDQKFINKIKKYCPQ
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggggcggcggattgaaatgtcgggcattctggccgcgggtaaatccaccttatgcgat
atttttgcgcgcaatggatttaccattggccgcgagaatgttcaggacaatccctattgg
gccaaagtgcaggttgatcccaaaacatatgaaccgttgcttcaggaatggattctgaaa
caacgatttaatgaagttgcacgatccgaatccgcgggtgccacgccgttgcagatgatt
gatttctgcctggcggtggacaaggcctacgccgatttttatatggccgaatccgccccc
gaaaaaatgcgtaaaacccatgatgcgattgataacatgtatgccacttatggtgacccg
gcattgatcgttcatttgcattgcgacagtaccgaattgatccgccgtattgaaaagcgg
ggccgtttttttgaacagagccacacggttgaatttctggattccttgaatgggaaaatc
tgccactacctggatcgtgtgaagtcaaagggaacaatccctgtactggagtttgatatg
acccacggcggccccaaaattgaccagaagttcatcaataaaattaagaaatattgcccg
caatga

DBGET integrated database retrieval system