KEGG   Micavibrio aeruginosavorus ARL-13: MICA_1315Help
Entry
MICA_1315         CDS       T01630                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MICA_1315 (tpiA)
   01230 Biosynthesis of amino acids
    MICA_1315 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MICA_1315 (tpiA)
   00051 Fructose and mannose metabolism
    MICA_1315 (tpiA)
   00562 Inositol phosphate metabolism
    MICA_1315 (tpiA)
Enzymes [BR:mai01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MICA_1315 (tpiA)
Exosome [BR:mai04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MICA_1315 (tpiA)
  Exosomal proteins of bladder cancer cells
   MICA_1315 (tpiA)
  Exosomal proteins of melanoma cells
   MICA_1315 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1307937..1308704)
Genome map
AA seq 255 aa AA seqDB search
MTTKKKLIAGNWKMHGTLVSVRQLAEAVIDGVEKDASLLDRCDFLVCPTFIHIPAVRAVI
DHNRGALRVGGQDCSPHETGAFTGDIAAPMLKDVGCSAVILGHSERRQHHAEGDQTVAAK
AVQAHQAGLMTIICVGETEAQRVAGQEKTIVKQQLDGSIPAGATASNTVIAYEPVWAIGT
GKTATPADVAAMHAFIRGILVGKMADGAGVRILYGGSVKPENAGELLAIPDVDGALIGGA
SLKADQYLAIAKAVQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaagaaaaagctgattgctggaaattggaagatgcacggaacgctggtcagc
gttcgtcaattggccgaggccgtaattgatggcgtggaaaaagatgccagcttgctggat
cgctgcgattttctggtttgccctacctttatccatattccggccgtccgggccgtgatt
gaccataatcgcggcgctttgcgcgttggcgggcaggattgttcgccccatgagacgggt
gcattcaccggggatattgccgcgccgatgctcaaagatgtgggctgttccgccgtaatt
ctgggccattccgagcgccgccagcaccatgcggagggggaccaaaccgtggccgccaag
gcggttcaggcgcatcaggcggggttgatgaccattatctgcgtcggggaaaccgaggcg
cagcgcgtggcgggtcaagaaaaaacaattgtaaaacaacagcttgatggatcgatcccg
gctggggcaacggcatcgaatacggtgattgcctatgaaccggtctgggccattggcacg
ggcaaaacggcgaccccggcggatgttgcagccatgcacgcttttatccgcgggattttg
gtggggaaaatggcggacggggccggggtgcggattttgtatggcgggtcggtaaaaccg
gagaatgccggggaattgctggctattccggatgtggacggggccctgatcggcggggcc
agtttaaaggcggaccaatatctggctattgccaaagcggtgcaataa

DBGET integrated database retrieval system