KEGG   Micavibrio aeruginosavorus ARL-13: MICA_175Help
Entry
MICA_175          CDS       T01630                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mai00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MICA_175 (recR)
DNA repair and recombination proteins [BR:mai03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MICA_175 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(181168..181794)
Genome map
AA seq 208 aa AA seqDB search
MSQTSNYGRDDGPMDQLIRAFANLPGLGPRSARRIALHLLSRKDSAMKPLAHALDHAAET
IRTCSACGNLDMADPCRVCQDTSRNARTLCVVSGVSDLWAIERTGAYKGRYHILGGLLSA
LDGIGPQDLRIASLLERVRHDGFDEIILALAATVDGQATAHYITDRLHGNNSGNQAVKIT
RLAHGIPVGGDLDYLDDGTIATALKSRA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaccagcaattatgggcgtgacgatggcccgatggatcaattgatccgcgcc
tttgccaatttacccggactggggccgcgttcggcgcggcggattgcgttgcatctgctg
tcgcgcaaggacagcgcgatgaaaccactggcccacgcgctggaccatgcggcggaaacc
atccgcacctgttccgcgtgcggcaatctggatatggccgatccgtgccgcgtgtgtcag
gacaccagccgcaatgcccgcacattgtgcgtggtatccggcgtgtcggatttatgggcg
attgaacgcacgggtgcgtataaagggcgctatcacattctgggtggattgctgtccgca
ctggacgggatcgggccacaggatctgcgcattgcatcgctgctggagcgtgtgcgccat
gacgggttcgatgaaatcattctggcgctggccgcgacagtggacgggcaagccacagcc
cactacatcaccgatcgtctgcatggcaataacagcgggaatcaggccgtaaaaatcaca
cggctggcccacggcattccggtgggcggggatctggattatctggatgatggcaccatc
gccacggcgttgaaatcgcgtgcgtga

DBGET integrated database retrieval system