KEGG   Micavibrio aeruginosavorus ARL-13: MICA_185Help
Entry
MICA_185          CDS       T01630                                 

Definition
cytochrome c domain-containing protein
Orthology
K08738  
cytochrome c
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Sulfur metabolism
Metabolic pathways
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mai00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mai02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
189465..190097
Genome map
AA seq 210 aa AA seqDB search
MDNMEFNKIFAAVLVAGIVASLTGFISYTVIHPHKLDENAYKIEGVVEDGAGAAAAPTGP
QPILAMLASADVARGEQAAKACAACHSFNKGGANGIGPNLYGIVNANKAHLAGFAYSEGV
KTKGGKWDYDSLNHFLWKPKAYIADTKMNFIGLKKPEDRAAVIAWLRTLSDSPAGLPSAA
QIAAEEAELAPPAPAAEAAPAEAKPAEAAH
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggacaacatggaattcaacaaaattttcgccgccgtgctggtggccggtatcgtcgcc
agcctgacgggattcatttcttatacggtgattcatccgcataaattggatgaaaacgcc
tataagatcgaaggcgtcgtcgaagatggcgcgggtgccgctgctgcaccgacgggcccg
caaccgattctggcgatgctcgcttccgccgatgttgcgcgtggtgaacaggcggccaag
gcttgcgcggcgtgccacagctttaacaagggcggcgccaacggcatcggtccgaacctg
tacggcatcgtgaacgcgaacaaagcccacctggccggcttcgcgtattccgagggcgta
aagaccaagggcggcaaatgggattacgacagcctgaaccatttcctgtggaagccgaaa
gcctatatcgccgacacgaaaatgaactttatcggcctgaaaaaaccggaagaccgcgct
gctgtcatcgcttggctgcgcacgctgtctgattctccggcgggcctgccctctgcggcc
cagattgctgcggaagaagccgaactggctccgccagcgccggctgccgaagcggccccg
gctgaagccaaaccggcagaagccgcgcactaa

DBGET integrated database retrieval system