KEGG   Micavibrio aeruginosavorus ARL-13: MICA_185Help
Entry
MICA_185          CDS       T01630                                 

Definition
(RefSeq) cytochrome c domain-containing protein
  KO
K08738  
cytochrome c
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MICA_185
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MICA_185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
189465..190097
Genome map
AA seq 210 aa AA seqDB search
MDNMEFNKIFAAVLVAGIVASLTGFISYTVIHPHKLDENAYKIEGVVEDGAGAAAAPTGP
QPILAMLASADVARGEQAAKACAACHSFNKGGANGIGPNLYGIVNANKAHLAGFAYSEGV
KTKGGKWDYDSLNHFLWKPKAYIADTKMNFIGLKKPEDRAAVIAWLRTLSDSPAGLPSAA
QIAAEEAELAPPAPAAEAAPAEAKPAEAAH
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggacaacatggaattcaacaaaattttcgccgccgtgctggtggccggtatcgtcgcc
agcctgacgggattcatttcttatacggtgattcatccgcataaattggatgaaaacgcc
tataagatcgaaggcgtcgtcgaagatggcgcgggtgccgctgctgcaccgacgggcccg
caaccgattctggcgatgctcgcttccgccgatgttgcgcgtggtgaacaggcggccaag
gcttgcgcggcgtgccacagctttaacaagggcggcgccaacggcatcggtccgaacctg
tacggcatcgtgaacgcgaacaaagcccacctggccggcttcgcgtattccgagggcgta
aagaccaagggcggcaaatgggattacgacagcctgaaccatttcctgtggaagccgaaa
gcctatatcgccgacacgaaaatgaactttatcggcctgaaaaaaccggaagaccgcgct
gctgtcatcgcttggctgcgcacgctgtctgattctccggcgggcctgccctctgcggcc
cagattgctgcggaagaagccgaactggctccgccagcgccggctgccgaagcggccccg
gctgaagccaaaccggcagaagccgcgcactaa

DBGET integrated database retrieval system