KEGG   Micavibrio aeruginosavorus ARL-13: MICA_1884Help
Entry
MICA_1884         CDS       T01630                                 

Definition
alpha/beta hydrolase fold family protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:mai00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1866790..1867884
Genome map
AA seq 364 aa AA seqDB search
MPAIRSLTDSFNRVSMPPEGWHEAMFVNADNQRIRYAQIPAHTAPGESPRGTVVLTHGYG
EFVDLYYEAIKEYQAQGFNVWAMDWQGFGGSDRDNPDKPHLVDAQGMNQHVRDLNQFVRN
VVQHDKNTPLIMSTHSMGGHPGMLYLQRHPGVFDAAVMSAPMFDIHRLGAGPWARPLVHA
IFNAASHIGLQDRPVPALEGVLAKVGQWREEDGRRTVGMHNLREVWSNAVRANAPEHNIA
RPSFGWINSVYDTVKELNDPTNLRKVTIPVLIGSAGHETLVDNGAHARAAAALPNAKHIT
LPTAGHSLWLQDEPNYTRWASSVNGFLEATVHDFYNRRNAPTPAPPPDPAQIVTRAPQAA
PNAA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgccggcaatccggagtctgaccgacagtttcaatcgcgtaagcatgccgcccgagggc
tggcacgaagccatgttcgtcaacgcggacaatcagcgcattcgttatgcacaaatcccc
gcccatacggcccccggtgaatcgccacgcggtaccgtcgtgttgacacatggctatggt
gagtttgttgatctgtattacgaagcgatcaaggaatatcaggcgcaggggttcaatgtc
tgggccatggattggcagggctttggcggatccgaccgcgacaatcccgacaaaccgcat
ctggtcgacgcacagggcatgaatcaacacgtgcgcgatctgaaccaatttgttcgtaac
gttgtccagcacgataaaaatacacccctgatcatgtcgacccattccatgggcgggcac
cccggcatgctgtatctgcaacgccatcccggcgtttttgacgccgcagtgatgagcgcg
ccgatgtttgacattcaccgcctgggagccgggccatgggcgcgcccgctggtacacgcg
atttttaacgccgcatcccatatcggtttacaagatcgccccgtccccgcattggaaggc
gttttggccaaagtcgggcaatggcgtgaggaagatgggcgccgcaccgtcggcatgcac
aatttgcgcgaagtgtggagcaacgccgtgcgggccaatgccccggaacacaatatcgca
cgccccagttttggatggatcaattccgtttatgacaccgtgaaggaattgaatgacccc
acaaatttgcgcaaggtcaccattcccgtcctgatcggcagcgccgggcacgaaacgctg
gttgataatggggcacatgcccgtgcggcggcagccctgcccaacgcaaagcacatcacc
ctgcccacggcgggacacagcctgtggcttcaggatgagccgaattatacccgttgggca
tccagcgtgaatggattcctggaggcgaccgtgcatgatttttacaatcgccgcaacgca
ccaacgcccgcgccgcccccagatccggcccagatcgtgacacgggccccgcaagccgcg
ccaaacgccgcataa

DBGET integrated database retrieval system