KEGG   Micavibrio aeruginosavorus ARL-13: MICA_1941Help
Entry
MICA_1941         CDS       T01630                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
mai00240  Pyrimidine metabolism
mai00250  Alanine, aspartate and glutamate metabolism
mai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MICA_1941 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MICA_1941 (pyrB)
Enzymes [BR:mai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MICA_1941 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace VAPB_antitox
Motif
Other DBs
NCBI-ProteinID: AEP10250
UniProt: G2KNK5
Position
1925262..1926170
Genome map
AA seq 302 aa AA seqDB search
MKHCTGIQNLSDADIDAILSRAQTYADQINAGQPITPSLNGRIVMNLFFENSTRTRTSFE
TAALRLGANVINWDVESSSIKKNESFSDTIQTLAEYDPDAIIIRHSEYGAPDYVASMVKC
PVINAGDSWREHPTQALLDAFTIRQAKGRIEGLTIAICGDIAHSRVAASNMALLTRLGAK
VRVIAPDFLMPEKPLAAGIEKFTSMDAGLPGCDIVMMLRNQKERMDPSRMPSDIAFFNQY
GLTIDRLDLAKPDACVMHPGPMNRGVEIADDVADDPTRSLILKQVRNGVPVRMAVLDLLI
NR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacactgcaccggcatacagaatttaagcgacgcggatattgacgccattttatca
cgcgcccaaacctatgccgatcagatcaatgcgggccagcccatcaccccctccttaaac
ggacggattgtgatgaatctgtttttcgaaaattccacccgcacgcgtacatcgtttgaa
acggccgccctgcgtctgggggccaatgtcattaactgggacgttgaatccagttcgatc
aaaaagaacgaaagtttttcagacacaatccagacgctggccgaatacgacccagatgcc
atcatcatccgccattccgaatatggcgcgcccgattatgtggcctccatggtcaaatgc
ccggtgatcaatgccggggattcatggcgcgaacacccgacgcaagcgttgttggacgcc
ttcaccatccgtcaggccaagggccggatcgaaggattgaccatcgccatttgcggcgat
atcgcgcacagccgtgtcgccgcatccaacatggccctgttgacccgattgggggcaaag
gtccgcgtgattgcgcccgacttcctgatgccggaaaaaccgctggccgctggcattgaa
aaattcacatcaatggacgcgggcttgcccggttgcgacattgtcatgatgttgcgcaat
caaaaggaacgcatggacccatcgcgcatgccatccgacattgccttcttcaatcaatat
ggcctaaccatcgatcgtctggatctggccaagccggatgcgtgcgtcatgcatccgggc
cccatgaaccggggcgtggaaattgccgatgacgtcgccgatgacccgacccgatccctg
attttaaaacaggtgcgcaacggcgtccccgtgcgcatggccgtgctcgaccttttaatc
aaccgctaa

DBGET integrated database retrieval system