KEGG   Micavibrio aeruginosavorus ARL-13: MICA_1982Help
Entry
MICA_1982         CDS       T01630                                 

Gene name
ispE
Definition
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MICA_1982 (ispE)
Enzymes [BR:mai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     MICA_1982 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1971715..1972620
Genome map
AA seq 301 aa AA seqDB search
MGPLSYLAPAKINLYLHITGRRDDGYHLLDSLVGFSDIGDRLTITPADQFSLRIDGPFAK
NFTAPDMDASPQSGNLVARAAWAMARATGRANPGVAIHLSKNLPLASGIGGASSDAATTI
RGLCQLWRVDPDADFIAPLALSLGADVPVCLRGTAAFMRGIGDVVTPAPAIPAGLGAGMD
IVLVNPLVPCPTPGVFRAYAQDQAPFSAPLVADPQWQDSGDFIAALRSTRNDLTAAATAT
VPAIRTILDALGAMDGCALARLSGSGATCFGLFASPAAAEQAAAKIKTHHPGWWVSHGII
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggccctttatcatatctcgcacccgccaagatcaatttatatctgcacatcaccggg
cgccgggatgacggatatcacctgcttgattcactggtggggttttccgacattggcgat
cgcctgaccatcacaccggctgatcaattttcgttacgcattgatggcccgtttgcaaaa
aacttcaccgcacccgatatggacgccagcccgcaatccgggaatttggtcgcacgggca
gcgtgggccatggcgcgcgccacaggccgggcaaatccgggtgtggccatacacctgagc
aagaacctgccgctggcgtccgggattgggggcgcgtccagcgatgccgccaccaccatc
cggggactgtgccaattatggcgcgttgatccggacgcggatttcatcgcgcccctggcc
ctctcgttgggggcggatgttcctgtctgcctgcgcgggacggcggcttttatgcgcgga
attggcgatgtggttacaccggcccccgccattccggcgggtctgggcgcaggtatggac
atcgtgctggtcaatccactggttccctgtcccaccccgggtgtcttccgtgcctatgcc
caagaccaggcacccttctccgctccgttggtggctgatccacaatggcaggacagcggt
gattttatcgcggccctgcgctccacgcgcaatgacctaaccgccgccgcaaccgccacc
gttcccgccattcgcaccattctggacgcactcggcgcaatggatggctgcgcgctggcg
cgcctgtctggcagcggggcgacatgcttcggcctgttcgcatcccccgccgcagcggag
caggccgccgcaaaaatcaaaacccaccatccgggatggtgggtttcacacgggatcatt
ttctga

DBGET integrated database retrieval system