KEGG   Micavibrio aeruginosavorus ARL-13: MICA_1996Help
Entry
MICA_1996         CDS       T01630                                 

Definition
(GenBank) 2-oxoacid dehydrogenases acyltransferase family protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
mai00010  Glycolysis / Gluconeogenesis
mai00020  Citrate cycle (TCA cycle)
mai00620  Pyruvate metabolism
mai01100  Metabolic pathways
mai01110  Biosynthesis of secondary metabolites
mai01120  Microbial metabolism in diverse environments
mai01130  Biosynthesis of antibiotics
mai01200  Carbon metabolism
Module
mai_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MICA_1996
   00020 Citrate cycle (TCA cycle)
    MICA_1996
   00620 Pyruvate metabolism
    MICA_1996
Enzymes [BR:mai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MICA_1996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl GCV_H
Motif
Other DBs
NCBI-ProteinID: AEP10304
UniProt: G2KNQ9
Position
complement(1987955..1988947)
Genome map
AA seq 330 aa AA seqDB search
MDGALEITVPNLGEGVRYVTVKSILRSNGEFVREDEGVIEVETDKAVVEIPSPTDGCVCN
ITCKPGDILPVGSNLLIIRKNLKGEGETTFLASNQKRKKDSVPSKNINIESGNSKREETL
SACQQALVGSMKKSAAIVVPATVERDISWDFIDLIKKHFRKNEKNVVPRSMEIICWAISK
SIERFDKFKIKIDFDDTIIFSEKTILGIAVADNNDDLLNHVVSVYQCSDVISFVNTFRSS
LVRREKGYHSVSISDMSSLGAHRATPVVVHPSVATIFIGSPFDIFTKNGWGRKASLSVTF
DHRVMNGAYVAAFLVDIEDNIKAYAKLLGV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggatggtgccttggaaatcacagttcctaatcttggtgagggtgttcgctatgtaacg
gtaaaaagtatattgcgctcaaacggcgagttcgttcgcgaagatgagggggttattgaa
gttgaaaccgataaagctgttgtcgaaattccatctccgacagatgggtgtgtttgcaat
ataacctgtaagccaggggacattctccccgtgggatcaaatctcttgattatacgaaaa
aatctaaaaggtgagggcgaaacaacgtttttagcctctaatcaaaaaagaaaaaaggat
agtgttccgtcaaaaaatattaatatagaaagcggtaatagcaaaagggaagaaacgctg
tccgcgtgtcagcaggccctcgtcggatcaatgaagaaatcagccgcgattgttgttcct
gcaacggttgagcgagatatttcttgggatttcattgatctcataaagaaacattttcga
aaaaatgaaaaaaatgttgttcctcgctctatggagatcatctgttgggcaatatcaaaa
tcaatcgaaaggtttgataagttcaaaattaaaattgattttgacgatacgattattttt
tcggaaaagaccattctcggcattgccgttgcggataataatgatgatcttctcaatcac
gtggtatcagtatatcagtgctctgacgttatctccttcgtaaatacttttcgttcttct
ttggtaagacgtgaaaagggttatcactctgtatccattagcgacatgtcatcgctaggc
gcgcatcgagctacgcccgtagtagtgcatccatccgtggcaacaatttttattggatca
cccttcgatatatttacaaagaatggatggggcaggaaggcatcgttgtccgttacgttt
gatcatcgcgtaatgaacggtgcctatgttgcggcgtttctagtggatattgaggacaat
ataaaggcttacgctaaattactgggggtttag

DBGET integrated database retrieval system