KEGG   Micavibrio aeruginosavorus ARL-13: MICA_2006Help
Entry
MICA_2006         CDS       T01630                                 

Definition
O-glycosyl hydrolase 30 family protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MICA_2006
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MICA_2006
Enzymes [BR:mai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     MICA_2006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2002215..2003549)
Genome map
AA seq 444 aa AA seqDB search
MLMDVFTTTGDRAALLAHRRHTLSALFRDNAYPTLTVDAAHTHQSMDGFGFSLTGGSAML
IARLAPSARQDLLRELFTRDGRGIGVSFLRLTIGASDLSTKSYSYNDLPPGQTDFSLSRF
DIMAGDEHVIPVLKDILSINPDIRIMASPWSAPPWMKDNGSFVGGSLKPDCYDVYARYLV
RYLETMKSHGIPVHAMTLQNEPHNHKNDPSMVMTASAQADFIQNHIGPMLQKSGLNTQIL
CWDHNCDEPDYPVAVLSDPAVKRYVTGVAFHLYNGGPEALSQVQALHPDQKMYLTEQWVG
ADGNFRDDLAWHARNVFIGVMRNGGRAVLEWNLASDPACGPHTPGGEPHCVGALTIDDQS
ITRNVAYYLIGHAAKFIPPGSVRVESNDHDILRNVAFHTPDGRMVMMVLNDSDRNQRFNI
RHGEKQATITLKAGAVSTCSWSAP
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgttgatggatgtttttacgacgacgggggaccgcgccgcgctgttggcgcatcggcgg
cacacgctgtctgccctttttcgtgataatgcatatccgacattgaccgttgatgcggcc
catacccaccaaagcatggacggttttggattttccctgacagggggcagcgccatgtta
atagcaaggctggcgccatctgcgcgccaggatttgctgcgcgaattatttacccgagac
gggcgggggatcggtgtcagttttctgcgtttgacgattggcgcatcggacctcagcacc
aaaagttattcttacaacgaccttcctcctggccagacggatttttccctgtcgcgtttt
gatattatggcgggggatgaacatgtcatccccgtgctgaaagacatcctgtccatcaac
ccggatatacggatcatggccagtccgtggtctgcgccgccatggatgaaggataatggc
agtttcgtgggcgggtcgttgaaaccggactgttatgacgtgtatgcgcgctacctcgtc
cgctatcttgaaacgatgaagtcgcatggtattcccgttcatgccatgacgttgcaaaat
gaaccgcataaccacaaaaacgaccccagcatggtgatgaccgcgtccgcacaggcggat
tttattcaaaatcatattgggcccatgttgcaaaaatccggtttgaatacacaaattttg
tgctgggatcataattgcgatgaaccggattatccggtcgcggtcttatccgatccggcg
gttaaacgctatgtgacgggggttgcctttcacctctataacggcgggcccgaggccttg
tcacaggttcaggccctgcacccggatcaaaaaatgtatctgaccgaacaatgggtgggg
gccgatggcaatttccgggacgatctggcgtggcatgcgcgcaatgtttttattggtgtg
atgcgcaatggcggccgtgctgttctggaatggaacttggcgtctgatccggcttgcggg
ccgcatacgccgggcggtgaaccgcattgtgttggcgcgttgacgattgatgatcaatcc
atcacgcgcaatgtcgcgtattatctgattggccatgccgcaaaattcatcccaccgggg
tctgtgcgggttgagtccaatgatcatgatatactgcgcaatgtggcattccacacacct
gatgggcgcatggtcatgatggtgttgaacgacagtgatcgaaaccagcgattcaatatc
cgccatggcgaaaaacaggcaacgataaccctgaaggctggtgcggtgagtacgtgcagc
tggtccgcgccctag

DBGET integrated database retrieval system