KEGG   Micavibrio aeruginosavorus ARL-13: MICA_2006Help
Entry
MICA_2006         CDS       T01630                                 

Definition
O-glycosyl hydrolase 30 family protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2002215..2003549)
Genome map
AA seq 444 aa AA seqDB search
MLMDVFTTTGDRAALLAHRRHTLSALFRDNAYPTLTVDAAHTHQSMDGFGFSLTGGSAML
IARLAPSARQDLLRELFTRDGRGIGVSFLRLTIGASDLSTKSYSYNDLPPGQTDFSLSRF
DIMAGDEHVIPVLKDILSINPDIRIMASPWSAPPWMKDNGSFVGGSLKPDCYDVYARYLV
RYLETMKSHGIPVHAMTLQNEPHNHKNDPSMVMTASAQADFIQNHIGPMLQKSGLNTQIL
CWDHNCDEPDYPVAVLSDPAVKRYVTGVAFHLYNGGPEALSQVQALHPDQKMYLTEQWVG
ADGNFRDDLAWHARNVFIGVMRNGGRAVLEWNLASDPACGPHTPGGEPHCVGALTIDDQS
ITRNVAYYLIGHAAKFIPPGSVRVESNDHDILRNVAFHTPDGRMVMMVLNDSDRNQRFNI
RHGEKQATITLKAGAVSTCSWSAP
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgttgatggatgtttttacgacgacgggggaccgcgccgcgctgttggcgcatcggcgg
cacacgctgtctgccctttttcgtgataatgcatatccgacattgaccgttgatgcggcc
catacccaccaaagcatggacggttttggattttccctgacagggggcagcgccatgtta
atagcaaggctggcgccatctgcgcgccaggatttgctgcgcgaattatttacccgagac
gggcgggggatcggtgtcagttttctgcgtttgacgattggcgcatcggacctcagcacc
aaaagttattcttacaacgaccttcctcctggccagacggatttttccctgtcgcgtttt
gatattatggcgggggatgaacatgtcatccccgtgctgaaagacatcctgtccatcaac
ccggatatacggatcatggccagtccgtggtctgcgccgccatggatgaaggataatggc
agtttcgtgggcgggtcgttgaaaccggactgttatgacgtgtatgcgcgctacctcgtc
cgctatcttgaaacgatgaagtcgcatggtattcccgttcatgccatgacgttgcaaaat
gaaccgcataaccacaaaaacgaccccagcatggtgatgaccgcgtccgcacaggcggat
tttattcaaaatcatattgggcccatgttgcaaaaatccggtttgaatacacaaattttg
tgctgggatcataattgcgatgaaccggattatccggtcgcggtcttatccgatccggcg
gttaaacgctatgtgacgggggttgcctttcacctctataacggcgggcccgaggccttg
tcacaggttcaggccctgcacccggatcaaaaaatgtatctgaccgaacaatgggtgggg
gccgatggcaatttccgggacgatctggcgtggcatgcgcgcaatgtttttattggtgtg
atgcgcaatggcggccgtgctgttctggaatggaacttggcgtctgatccggcttgcggg
ccgcatacgccgggcggtgaaccgcattgtgttggcgcgttgacgattgatgatcaatcc
atcacgcgcaatgtcgcgtattatctgattggccatgccgcaaaattcatcccaccgggg
tctgtgcgggttgagtccaatgatcatgatatactgcgcaatgtggcattccacacacct
gatgggcgcatggtcatgatggtgttgaacgacagtgatcgaaaccagcgattcaatatc
cgccatggcgaaaaacaggcaacgataaccctgaaggctggtgcggtgagtacgtgcagc
tggtccgcgccctag

DBGET integrated database retrieval system