KEGG   Micavibrio aeruginosavorus ARL-13: MICA_2028Help
Entry
MICA_2028         CDS       T01630                                 

Definition
response regulator
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mai02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mai02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2035274..2036404)
Genome map
AA seq 376 aa AA seqDB search
MTAITTGPQSPQEAPNIRVMIVDDSAVIRAVITRTLTPEQGIEVVGTAPNGDLAVKAIAR
LQPDIVVLDIEMPIMDGLTALPLLLKEKPDVRVLICSTLSARGADVTMKALALGATDSIL
KPGGESISSAADFQRDLVRVIRVLGRPRKKYAPANHTNGADAGTGAAKKLYPQTTVTLRP
HKAPLPPKILAIGSSTGGPKALMDMLKGLKNFPLPIVITQHMPKTFTAMLAQHIEQNCGI
PCFEGAEGMVLKPGSAYVAPGGLHMIFQKGTGEYPVIHLDSGPPENFCRPSVDVMLRSLV
DIYGSRILTVILTGMGSDGLEGCRKVVDNGGNVIAQDEETSIVWGMPGAVATAGLCSAVQ
PLSQLDVTIKKLVTGS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccattacgaccggcccgcaaagtccgcaagaggcgccgaatatccgcgtgatg
atcgtcgatgattcggcggttattcgcgcggttatcacgcgcaccttgacgccggagcag
ggcattgaggttgttggaacggccccaaatggtgatttggcagtcaaggcgattgcacga
ttgcagccggatatcgtcgttttggatattgaaatgccgattatggacgggctgacggcc
ttgcctttgctgctcaaagaaaagccggacgtgcgtgttctgatttgctcaaccctgtcg
gcgcgcggcgcggatgtgacgatgaaggcgctggccctgggggccacggacagtattttg
aaaccgggcggtgaatcaatttccagcgcggcggatttccagcgtgatctggtgcgtgtg
atccgggttctgggccggccacgtaaaaaatatgcaccagccaatcacacgaatggggct
gatgcaggcacgggtgcggcgaaaaaactgtatccgcagaccaccgtaacgttacgcccg
cataaagcgccattgccgccgaaaattctggcaattggcagctccaccggcgggccgaaa
gcgttgatggatatgctgaaggggttgaaaaactttccccttcccatcgtgattacccag
catatgccgaagacatttacggcgatgctggcgcaacatattgaacaaaactgcgggatt
ccgtgttttgaaggggctgagggaatggtgttgaaaccggggtctgcctatgtggcgccg
ggtggactgcacatgatctttcagaaaggtacaggtgaatatccggtgattcatctggat
tcggggccgccggaaaatttctgccgcccgtcggtggatgtgatgctgcgtagtctggtt
gatatttatggatcgcgaattctgaccgtcattctgaccggtatgggcagtgatggcttg
gaagggtgtcgcaaagtcgtcgataacgggggcaacgttatcgcacaggacgaagagaca
tccatcgtatggggtatgccgggggccgtggcaacggccgggctatgctctgcggtccaa
cctttatctcaattggacgtgacaattaaaaagcttgtcacagggtcataa

DBGET integrated database retrieval system