KEGG   Micavibrio aeruginosavorus ARL-13: MICA_2053Help
Entry
MICA_2053         CDS       T01630                                 

Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MICA_2053
Enzymes [BR:mai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MICA_2053
Transfer RNA biogenesis [BR:mai03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MICA_2053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2063543..2064391)
Genome map
AA seq 282 aa AA seqDB search
MNKLFDPAYYGALCNMVRRAAIAAGDETLNYFDESGVPETMIKADGSPVTLADHAAEEII
IKALADIDESVPVVAEESVAAGRIPDLAGVTRFWLVDPLDGTKGFISGSGEYCVNIALIE
NGVPALGVIYAPVVGELFAGYGAETALRYMVDDDQEKDIACRRAPRNGLTVMTTRHHGDV
DRLNGYLESLKVEKLLKRSSALKFCAIAFGKADLYIRAGETSEWDSAAGHAILLAAGGNV
VDQSGHPLTYGHADRGFRNPDFAAASDDVLPMLDGLFFTRAA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaataaactattcgacccggcttattatggggccctgtgcaatatggtccgccgcgcg
gccattgcggcgggggatgaaacgctgaattatttcgacgaatccggtgtgcccgaaacg
atgatcaaggccgatggatcacctgtgacgctggccgatcatgcggcggaagaaattatt
atcaaggcgctggccgatattgatgagtcggttcccgttgtggccgaggaatcggtggcg
gcggggcgtattcccgatctggcgggtgtgacgcgtttctggctggtcgatccgctggat
gggaccaagggctttatcagcggcagtggcgaatattgcgtcaatattgccctcatcgaa
aacggcgttccggcgttgggcgtgatttatgcgccggtggttggggaattgttcgccggg
tatggcgcggaaacggcgctgcgttacatggtggatgatgatcaggaaaaggacattgcc
tgccgccgtgcgccgcgcaacgggttgaccgtgatgaccacacggcatcatggtgatgtg
gatcgcttgaatggttatctggaatcgctgaaggttgaaaaacttctgaagcgcagttcc
gcattaaaattctgcgccatcgcctttggcaaggcggatttgtacatccgcgcaggggaa
acatcggaatgggacagcgcggccgggcatgccattttgctggccgcgggtgggaatgtg
gtggatcaatccggccatcccttaacctacggccacgcggatcgcgggtttagaaacccg
gattttgccgccgcgtcggacgatgttttgccgatgctggacggattgttctttacgcgc
gccgcttga

DBGET integrated database retrieval system