KEGG   Micavibrio aeruginosavorus ARL-13: MICA_428Help
Entry
MICA_428          CDS       T01630                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
mai00010  Glycolysis / Gluconeogenesis
mai00620  Pyruvate metabolism
mai00640  Propanoate metabolism
mai00680  Methane metabolism
mai01100  Metabolic pathways
mai01110  Biosynthesis of secondary metabolites
mai01120  Microbial metabolism in diverse environments
mai01130  Biosynthesis of antibiotics
mai01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MICA_428 (acsA)
   00620 Pyruvate metabolism
    MICA_428 (acsA)
   00640 Propanoate metabolism
    MICA_428 (acsA)
  Energy metabolism
   00680 Methane metabolism
    MICA_428 (acsA)
Enzymes [BR:mai01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MICA_428 (acsA)
Lipid biosynthesis proteins [BR:mai01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MICA_428 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEP08771
UniProt: G2KS88
Position
complement(446462..448399)
Genome map
AA seq 645 aa AA seqDB search
MTKELFQPSAAITSKAHITAAQYDALYQRSISDPDGFWGDMADRITWFKKPTKIKNTSFN
APVSIKWYEDGVLNAAYNCIDRHLPARANQTALIWEGDNPNESKHITYAQLKDEVSKLAN
ALKARGVKKGDRVTIYMPMVPEATYAMLACARIGAVHSVVFGGFSPDSLKDRILDCDSNI
VITADEGLRGGKKVPLKKNTDEALKSCPDVSTVIVLKRTGGDVAWNAKRDVWWHDIVDTQ
STDCPCEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYMVYTSLTHEWVFDYQPGEVYWCT
ADVGWVTGHSYIVYGPLANGATSLIFEGVPNYPDFSRFWQVVDKHKVNIFYTAPTAIRAL
LREGDEWVKKTSRSTLRILGSVGEPINHEAWMWYNAVVGEGRCPIVDTWWQTETGGHMIT
PLPGAVATKPGSATKPFFGVAPEIVDGEGHIMNGPCEGNLCIADAWPGMMRTVFRDHARF
EQTYFSTFKGKYFTGDGCRRDDDGYYWITGRVDDVINVSGHRFGTAEIESAINEHDCVAE
SAVVGFPHDLKGQGIYAYVILNTGREPSEEMKKEIVQVVRKIIGPIATPDVIQWVSGLPK
TRSGKIMRRILRKVAAGEIDSLGDTSTLADPAVVDELLKNRQTPT
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggaactgttccagcccagcgccgccatcacatccaaggcgcatatcaccgcc
gcccaatatgacgctttgtatcaacgatccatcagcgacccagatgggttctggggtgac
atggcggaccggatcacgtggtttaaaaaacctaccaaaatcaagaacaccagtttcaac
gcccccgtgtcgatcaaatggtatgaagacggcgtattgaacgcggcgtataattgtatc
gaccgccacttgcccgcccgcgcgaaccagaccgcactgatctgggagggagataacccg
aatgagagcaagcacatcacctatgcccagttaaaggacgaagtgtccaaactggccaac
gcgttgaaagcgcgcggcgtgaagaaaggcgaccgcgtcaccatttatatgccgatggtg
ccagaggcgacatacgccatgctggcctgcgcccgcatcggggcggttcattcggttgta
tttggtgggttttcaccggattcattgaaagaccgcattctggattgcgattccaatatc
gtgatcactgcggatgaaggtctgcgcggtggcaagaaagtgccgttgaagaaaaatacg
gacgaagcgctgaaatcctgccccgacgtgtccaccgtgattgtcttgaaacgcaccggt
ggtgatgtcgcatggaatgcaaaacgcgatgtgtggtggcacgacattgtcgatacgcaa
agcaccgactgcccgtgcgaagaaatgaatgccgaagatcccctgttcattctttacaca
tcgggatcgaccggcaagccgaagggcgtgttgcacaccacgggtgggtatatggtgtat
accagcctgacccacgaatgggtgtttgattaccaaccgggcgaagtgtactggtgcacg
gccgatgtgggctgggtcaccgggcattcctatatcgtttatggtccgctggccaacggg
gccacgtcgttgattttcgaaggcgtcccgaattacccggacttttcccgcttctggcag
gtggtggacaagcacaaggtcaatattttctacaccgcccccaccgccattcgcgcgttg
ttgcgcgaaggggacgaatgggtcaagaaaaccagccgttccacattgcgcattttgggc
agcgtgggtgaaccgatcaaccacgaagcctggatgtggtataacgccgtcgttggcgaa
gggcgttgcccgattgttgatacatggtggcaaaccgaaaccggtggccacatgatcacg
cccctgcccggtgctgttgcaaccaaaccgggatcggccaccaaaccgttctttggcgtt
gccccggaaattgtcgatggcgagggccatattatgaatggcccatgcgaaggcaatttg
tgcatcgccgatgcctggcccggcatgatgcggaccgtattccgtgaccatgcgcgtttt
gaacaaacctatttcagcacgttcaaaggcaaatatttcaccggtgacggatgccgccgt
gacgatgatgggtattactggatcaccgggcgtgtggatgacgtgatcaacgtatccggc
caccgtttcggcacggccgagatcgaatccgccattaacgaacatgattgtgttgccgaa
tccgccgttgttggcttcccgcacgatttaaagggtcagggcatttatgcctatgtcatc
ctgaataccgggcgtgaaccgagcgaagagatgaaaaaggaaatcgtgcaggtggtccgc
aagatcatcggccccatcgccacgccggatgtgatccaatgggtcagcggactgcccaaa
acacggtcaggaaaaatcatgcgccgcattctgcgcaaggtcgccgctggtgagattgat
agcctgggcgatacatccacgctggccgatccggccgtggtggatgagttgcttaagaac
cggcaaacaccgacatag

DBGET integrated database retrieval system