KEGG   Micavibrio aeruginosavorus ARL-13: MICA_437Help
Entry
MICA_437          CDS       T01630                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MICA_437
Enzymes [BR:mai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MICA_437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
454707..455426
Genome map
AA seq 239 aa AA seqDB search
MIFSGFCRPIVLVTRPADDAGDLCDALRTAGFIPMLAPMLDIIPLHPTLPSFDDIQAIVF
TSMNGVRHCPDVPRDLPVYCVGDRTADAARDAGFKTVVSAGGDINDLETVLTGANLDPNR
VILHVCGADVVRPMVVPGVRIAPLVVYRADMVTRLPWVVRVMIRLGCVTGVLFFSARTGQ
AFVNTMKKMNLDRACAGIGALCLSDSVVESVSDLPWRGLYTAQRPDRAAMLDLLDHLRP
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgattttttccggcttttgtcggccgattgttctggtcacgcgcccggcggatgatgcc
ggggatttgtgtgacgcactccgcaccgccggatttattccgatgctggcaccgatgctg
gatatcattccgctgcacccgacactcccatcctttgatgatattcaggcgattgtgttc
accagcatgaatggcgtgcggcattgtccggatgttccgcgtgatctccccgtttactgt
gtcggtgatcgcacggcggatgcggcgcgtgatgcgggttttaaaacggtggtcagcgcc
ggtggcgatatcaatgatctggaaaccgttttaacgggtgcaaatctggatccgaaccgg
gtcattctgcatgtctgtggggccgatgtggtccgccccatggtcgtgcccggcgtacgg
attgcgccgttggtggtctatcgcgccgatatggtcacacgcctgccatgggtggtgcgg
gtgatgattcggctgggctgtgtcacgggcgttttgtttttttcggcacggacggggcaa
gcctttgtgaatactatgaaaaagatgaatttggatcgggcgtgcgcgggcatcggggcc
ttgtgtctgtcggattcagtggtagagtctgtatcggacctgccatggcgcggactctat
actgcacaacgccccgaccgggccgccatgctggaccttttggatcatctgcgtccttaa

DBGET integrated database retrieval system