KEGG   Micavibrio aeruginosavorus ARL-13: MICA_494Help
Entry
MICA_494          CDS       T01630                                 

Definition
arginase family protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mai01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mai00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
511096..512079
Genome map
AA seq 327 aa AA seqDB search
MTTPSDALLQVALIPYVCGAGAQTPGCEQGPLDFELRGLSDALQASGRDVWWSVDPEALL
AGPYGSSAHRDLPPLGSDERNEIVVWHVRGLADRVEEDVRNGAFVVTLGGDHSMAAGSIT
GLARGLKKTMGADVRLGLLWLDAHADLNTLATTPSKALHGMPLSQVLGLDVAHDPFGLGH
DAVVVAPSHLLYAGLRDLDPGEVDFIRDMNIHSFPMRDLVGKDLASTLIAAMAAMDVDVW
AISLDLDGLDPAFAPAVGTPVAGGLNHSDVLQALRAIMDRFDVRLFEVAEHNPTLKGAGV
NYQTALSTLQVVLDGATQRFKIRSDAA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccgtcggatgcgttgttacaggtcgccctgatcccctatgtctgtggcgcg
ggcgcacaaacccctggatgtgaacaggggccattggatttcgaattgcgtggcttgtct
gatgcgctgcaggcctcaggtcgcgatgtgtggtggagcgtcgatcccgaagcattactg
gccgggccatacgggtccagtgcccaccgcgacttgccgccattggggtccgatgagcgc
aacgagattgtggtctggcacgtgcgcggtctggccgaccgtgtggaagaagatgttcgc
aatggggccttcgttgtgacgctggggggtgatcacagcatggccgccggatcaataacc
ggtctggcccgtgggttgaagaaaacgatgggcgccgatgttcggctggggttgctctgg
ctggatgcgcatgcggatttgaacacactggcgaccaccccgtccaaagccttgcacggc
atgccgttgtcacaggttttggggctggatgttgcgcatgatccatttggtctggggcat
gacgcggttgttgtcgcgccctcgcacctgctttatgcgggattgcgtgatctggacccg
ggcgaggttgattttatccgtgacatgaatatccattcatttccaatgcgggatttggtc
gggaaagacttggcttcgacgttaatcgcggctatggctgcgatggatgtcgatgtgtgg
gccatttcgttggatctggatgggttggacccggcctttgctccggcggtgggtacaccg
gttgctggcggactaaaccatagcgatgttcttcaggccctgcgcgcgatcatggatcgt
tttgatgtgcgcctgtttgaagtggcggaacataacccgactctgaagggggctggggtt
aattatcaaaccgcattatctactttgcaggtggttttggatggggccacacagcgtttt
aagattcgatccgacgcagcgtga

DBGET integrated database retrieval system