KEGG   Micavibrio aeruginosavorus ARL-13: MICA_603Help
Entry
MICA_603          CDS       T01630                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MICA_603 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MICA_603 (glk)
   00052 Galactose metabolism
    MICA_603 (glk)
   00500 Starch and sucrose metabolism
    MICA_603 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    MICA_603 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MICA_603 (glk)
   00524 Butirosin and neomycin biosynthesis
    MICA_603 (glk)
Enzymes [BR:mai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MICA_603 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
602353..603327
Genome map
AA seq 324 aa AA seqDB search
MTATGLIADIGATNARFALVRNGVRNGALENVQVLKCADYATIVDAARAYLAMCGAPDVR
AASFAIAGPVTGDHFTMTNHPWDFSIEQTRLALGLDHFTLMNDFKAVALAIPHLHETDRR
QIGGTQTPVNESPIAVIGPGTGLGVGSLVWDGQAYRAIPGEGGHVTMPAKTQREFDVFQA
LHDKYRHISAERVCSGKGLVNIYNALRIIDHRNDLPDRSPEEISAAALDGSCTLCAEALR
MMIAFLGSIAGNLALTLGAAGGVYIAGGICAQLGEAFFQSDFRDQFESKGRFQSYLAPIP
TYLITHPFIAFIGLQAELKPFLCD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccacaggattgattgccgatattggcgcgaccaacgcccgctttgccttagtt
cgtaatggggtgcggaatggcgcgctggagaatgtgcaggttttgaaatgcgccgattac
gccacgatcgtggatgcggcgcgggcgtatctggccatgtgcggcgcgccggatgtgcgg
gcggccagctttgccattgccggcccggtgacgggcgaccatttcaccatgaccaaccat
ccgtgggatttttcgattgagcaaacacgccttgcgttggggctcgaccatttcacgttg
atgaatgattttaaggccgtcgcgctggccattccgcatttgcacgaaacggatcggcgg
caaattggtggcacacaaacgccagtgaatgaatcccccatcgctgtcattggccccggt
accggattgggtgtggggtcactggtctgggatggacaggcttatcgtgcgataccgggt
gagggtggccatgtcaccatgcccgcaaagacgcagcgtgaatttgatgtgtttcaggcc
ctgcacgacaaataccgccatatatccgccgagcgcgtatgttcgggcaaggggttggtg
aatatttacaatgccctgcgtattatcgaccaccgcaatgatttgccggatcgttcaccg
gaggagatcagcgcggccgctcttgatggatcctgcacactctgtgccgaggctctgcgt
atgatgattgccttcttgggcagcattgcgggcaatctggcgctgacgctgggggcggcg
ggtggtgtgtatattgcgggtggaatttgcgcacaactgggcgaggcatttttccaatcc
gatttccgcgatcaatttgaatccaaggggcggttccaatcctatctggcacccattcca
acctatctgatcacgcatcccttcattgcctttatcgggttacaggctgaattaaagccg
ttcttgtgcgattaa

DBGET integrated database retrieval system