KEGG   Micavibrio aeruginosavorus ARL-13: MICA_610Help
Entry
MICA_610          CDS       T01630                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MICA_610 (glpK)
Enzymes [BR:mai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MICA_610 (glpK)
Exosome [BR:mai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MICA_610 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
612563..614047
Genome map
AA seq 494 aa AA seqDB search
MQKTTILAIDQGTTSSRAILFSASGDILAVRQKELELFYPHNGWVEQDPVNIWNDTLWAC
RAVMEDSPDAAANIAAIGITNQRETTIVWDRKTGEPVYRAIVWQDRRTADLCQKLKKAGH
EDAVRSKTGLLLDPYFSGTKLAWILDNVPGVRKRADAGDLAFGTVDCYLLWKLTGGRVHA
TDATNAARTMLYNIVTQEWDDDLLRLLNIPRGLLPDVRDNVADFGATDPALLGRSFTIGG
MAGDQQAAVVGQACFHDGMVKSTYGTGCFALMNIGGTFRESKNRLLTTPAYRLNGDITYA
IEGSIFVSGAAVQWLRDGLGLFRQASESEGLATSVADTNGVYLVPAFTGMGAPYWDADAR
GLLCGITRDVTAAHITRAALEAQAYQTRDLIGAMEADTGKKIDIIRADGGLVANKFVCQF
LADILNCPVDIPRVAETTALGAAYLAGLQAGVYNGLDDITNAWHAVRHYAPSMDVDTRDD
LYAGWRKAVERTLL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagacaaccatcctcgccatcgatcagggcacgacatcatcccgcgcgatttta
ttctccgccagcggtgacattctggccgtgcgtcaaaaggaactggaattattctatccc
cataatggctgggtggaacaggacccggtgaatatctggaacgatacgctctgggcctgt
cgcgccgtgatggaggattcaccggatgcggcggcgaatattgccgccatcggtatcacc
aatcaacgcgaaaccacgattgtttgggaccgcaaaacgggcgaaccggtttatcgcgcc
atcgtttggcaagaccgccgcaccgccgatctgtgccagaaattgaagaaagccgggcac
gaggatgccgtgcgctccaaaaccgggcttttgctcgatccgtatttttcgggcacgaaa
ctggcgtggatcttggacaatgttcccggtgttcgcaaacgggccgatgccggggatctg
gcctttggtacggtggattgttatttgctgtggaaattgacgggtgggcgtgtgcatgcc
accgatgccaccaatgccgcacgcacgatgctctataacattgtgacgcaagaatgggac
gatgatctgctccgcctgctgaatatcccgcgtggcttgttgcccgatgtgcgcgataac
gtggccgattttggggcaaccgatccggctttgctgggacgctctttcaccattggcggt
atggcgggtgaccagcaggccgctgtggtggggcaggcgtgcttccatgatggcatggtg
aaatccacctatggcaccggatgttttgcgctgatgaatattggcggtacgttccgggaa
tcgaaaaaccgccttctgaccacgccggcctatcgtttgaacggtgatattacttacgcg
attgaggggtccattttcgtctctggtgccgccgtgcaatggctgcgcgatggactgggc
ctgttccggcaggcgtcggaaagcgaagggctggcaacatccgttgccgataccaatggc
gtttaccttgtcccggccttcaccggcatgggtgccccgtattgggatgcggatgcgcgc
gggctgctctgtggtattacgcgcgacgtcaccgccgcccatatcacccgcgccgcgtta
gaggcccaagcctatcaaacccgcgatctgatcggcgcgatggaggcggacacaggcaaa
aaaatcgacattatccgcgccgatggcggattggtggcgaataaattcgtctgccaattc
ctggccgacatcctgaattgccccgtcgatattccccgcgtggccgaaacaacggccctg
ggcgcggcgtacctggccgggttacaggcgggcgtttataacggtctggatgatatcacc
aacgcctggcacgccgttcgccattacgccccatccatggatgttgatacgcgggatgat
ttgtacgccggatggcgtaaggcggtggaaaggacgctgctctag

DBGET integrated database retrieval system