KEGG   Micavibrio aeruginosavorus ARL-13: MICA_649Help
Entry
MICA_649          CDS       T01630                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA ligase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MICA_649 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MICA_649 (sucC)
   00640 Propanoate metabolism
    MICA_649 (sucC)
   00660 C5-Branched dibasic acid metabolism
    MICA_649 (sucC)
Enzymes [BR:mai01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MICA_649 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
643738..644940
Genome map
AA seq 400 aa AA seqDB search
MNIHEYQGKALLKKYGVLVPEGIPAMTVAEAVAAAKQLPGPLYVVKSQIHAGGRGAGKFK
NNPEGKGGVRLCKTVDDVKDAAEAMLHQVLVTKQTGPDGQKVQRLYVTDGVDIQKEYYCS
VVLDRATSRVTFMVSTEGGMDIEEVAETHPEKIIRCAIDPVTGMQGFHARKLAFGLGLSG
DALKSAQKFFMSLYKAFVDMDCSIVEINPMIVTDKNEVMALDAKLNFDDNALFRHPDIAD
LRDEAEEDENERLAKDWELSYVRLDGNIGCMVNGAGLAMATMDIIKLYGGEPANFLDVGG
GATTERVTAAFKIILSDPNVKGVLVNIFGGIMKCDIIANGIIAAAKEVSLSVPLVVRLEG
TNVEQGKKILRESGLPITSADNLADAAQKVVDATKKALAA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgagtatcaaggcaaagccctgctgaaaaaatacggcgttctggtgccc
gagggcattccggccatgacggttgccgaggctgtggccgcggcgaaacaactgccaggt
ccgctgtatgttgtaaaatcccaaatccatgcgggcggccgtggcgccggtaaattcaaa
aacaatccggaaggcaagggcggtgttcgtctgtgcaaaacggttgatgatgtgaaagac
gccgccgaggcgatgctgcaccaggttctggtgaccaagcagaccggaccggatggtcag
aaggttcaacgcctgtacgtcaccgacggtgtggacattcaaaaagaatattactgctcc
gtcgttctggaccgcgcaacgtcccgcgtgacgttcatggtgtccaccgaaggcggcatg
gatatcgaagaagtggccgaaacccacccggaaaaaatcattcgctgtgcgattgacccg
gtgacgggcatgcagggcttccacgcccgcaagctggccttcggtctgggcctgtccggc
gatgcgctgaagagcgcgcaaaaattcttcatgtccctgtacaaagcattcgtggacatg
gattgctcgatcgttgaaatcaacccgatgatcgtgaccgacaaaaacgaagtgatggcg
ttggacgccaaactgaacttcgacgacaacgccttgttccgtcacccggacattgccgat
ctgcgcgatgaagccgaggaagacgagaatgagcgtttggccaaggattgggaattgtcc
tatgtccgcctggacgggaacattggctgcatggtcaatggcgccggtctggccatggca
accatggacattatcaaactgtatggtggtgaacctgcaaacttcctggatgtgggcggc
ggtgcaacgaccgaacgcgtgaccgcagccttcaagatcattctgtctgatccgaatgtg
aagggcgtattggtcaacattttcggcggcatcatgaaatgcgacatcattgccaacggc
attatcgccgcggcgaaggaagtgtcgctgtcggttccgctggtcgttcgtctggaaggc
accaacgttgagcagggtaagaaaattctgcgcgaaagcggtttgccgatcacgtccgcg
gataatctggccgatgcggcccagaaggtcgtggatgcaacgaaaaaagcgctggccgct
taa

DBGET integrated database retrieval system