KEGG   Micavibrio aeruginosavorus ARL-13: MICA_658Help
Entry
MICA_658          CDS       T01630                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MICA_658 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MICA_658 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MICA_658 (sucB)
Enzymes [BR:mai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MICA_658 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
652324..653529
Genome map
AA seq 401 aa AA seqDB search
MAQIKVPTLGESVTEATVAQWLKKEGDVVAADEPIVELETDKVTLEVNAPSAGVLVSIGV
KSGETVGVGAILGEIANDAGAKPSAPAAAAPAPAATQAAAPAPAKTEEHKLSPAVQKMTA
DNAINPASVEGTGKDGRITKGDVINHIETARAPNAVTSAVQAAPRAIGPREERVKMTRLR
QRIAQRLKEAQNNAAMLTTFNEVDMTAVMELRNLYKDQFEKKHGVKLGFMSFFVKAAVNA
LKELPAVNAEISGDEIIYKNYYDIGVAVSTPQGLVVPVVRDCEEKSMATIESEIGALGLR
ARDGKITLEEMTGGTFTITNGGVFGSLMSTPILNPPQSGILGMHKIQQRPMVMPDGSIKA
RPMMYLALSYDHRIIDGREAVTFLVRIKDALEDPQRLLLDI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaatcaaagtcccgacgctgggtgaatccgtgaccgaggccactgtggcccaa
tggctgaagaaggaaggcgatgtcgtcgccgccgatgagccgatcgtggagctggaaacc
gacaaggtgacattggaagtcaacgcaccgtccgctggcgtgttggtcagcatcggtgtg
aagtcgggtgagacggttggtgttggtgccattctgggcgaaatcgctaatgatgcgggt
gcaaaaccgtccgcgcctgcggctgctgcgccagcaccggctgcgacccaggctgcagcc
cctgcacctgcgaaaacggaagagcacaaactgtccccggcggttcagaaaatgaccgcg
gacaacgccatcaacccggccagcgtagaaggcacgggcaaagatggccgcatcaccaag
ggtgacgtgatcaaccatatcgagaccgcccgcgcaccgaatgccgtgacgtccgccgtt
caagctgcaccgcgcgccattggcccgcgtgaagaacgtgtgaaaatgacccgtctgcgt
cagcgtatcgcgcagcgtttgaaagaggcccaaaacaatgccgccatgctgaccaccttt
aacgaggtggatatgacggccgtgatggaactgcgcaacctgtacaaggaccagttcgag
aagaaacacggcgtgaagctgggctttatgtccttcttcgtaaaggcggctgtgaacgcc
ctgaaagaattgccggccgtgaacgcggaaatttccggtgatgaaatcatctacaaaaac
tactacgacattggtgtggctgtttccacgccgcagggtctggtggttccggttgtgcgt
gattgcgaagaaaaatccatggcgacgattgaatctgaaatcggtgccctgggtctgcgc
gcacgtgatggaaaaatcacgctggaagaaatgacgggcggcacgttcaccatcaccaac
ggtggtgtgttcgggtccctgatgtccacgccgattttgaacccgccgcaatccggtatt
ctgggcatgcacaaaatccagcaacgcccgatggtgatgcccgatggttcgatcaaggcc
cgcccgatgatgtatctggcgctgtcctatgatcaccgcatcattgacggccgtgaagcg
gtgaccttcctggtccgtatcaaggacgcactggaagatccgcaacgtttgctgctggat
atctaa

DBGET integrated database retrieval system