KEGG   Micavibrio aeruginosavorus ARL-13: MICA_69Help
Entry
MICA_69           CDS       T01630                                 

Definition
diguanylate cyclase domain-containing protein
Orthology
K13590  
diguanylate cyclase
Organism
mai  Micavibrio aeruginosavorus ARL-13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
60157..61212
Genome map
AA seq 351 aa AA seqDB search
MNYPHEAHQAREFAEKAMTRILDEGLPPSPDIYELWYVYYAGISPEVTRALDILVSNRQK
ITEDRCRDPHTRFLSDARNEEMIRRAGDQVKATIKNVTGAVRDVKNATTSYSGTLEDVSK
KMGGAKTVDEMRNLVSGVMNDTQKMLEHNHKLEQELEQSSTLMEELQRDLEQVRKEAMTD
GLTGLANRKAFDAALDRVSSDTQSEQGSFTLLMVDIDHFKSFNDNYGHQVGDQVLRLVAR
TLIEGVKGKDIAARYGGEEFAIILPDTNLTAGVAVGNNLRKAVATKDVINRTTGEKLGRI
TMSVGVAEYINGENMTDLIERADAALYTAKHNGRNQVAAAPTPMGKRSNGA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgaactatccgcacgaagcacatcaggcccgggaatttgccgaaaaagccatgacgcgc
atccttgatgaaggattgccgccgtcgccggatatttacgagctgtggtacgtctactat
gccgggatcagcccggaggtgacgcgcgcgctggacatcctggtgtccaaccgccagaaa
attaccgaagaccgctgccgcgatccgcacacgcgtttcctgagcgatgcgcggaacgag
gaaatgatccgccgcgccggtgatcaggtgaaggcgaccattaaaaatgtgaccggggct
gtgcgcgacgtgaaaaacgccaccacgtcctatagcggtacgctggaagatgtatccaaa
aaaatgggcggcgccaaaaccgtggacgagatgcgcaatctggtgtccggcgtgatgaac
gatacacagaaaatgctggaacataaccacaagctggaacaggaactggaacaatcctcc
accttgatggaagagctgcaacgcgacctggaacaggtgcggaaagaggcgatgaccgat
ggcctgaccggcctggccaaccgcaaggcttttgatgcggcgctggatcgggtcagcagc
gatacgcaaagcgaacaggggtcgttcaccctgttgatggttgatattgatcacttcaaa
tccttcaacgacaattatggtcaccaggtgggggaccaggttttgcgccttgtcgcccgc
accttgatcgaaggggtgaagggtaaggacattgccgcgcgctacggcggtgaggaattt
gcgatcatcctgcccgacacgaatttgaccgcgggtgtggccgttgggaacaatttgcgc
aaggcggttgcgaccaaggatgtgattaaccggaccacgggtgaaaaactgggccgtatt
accatgtctgtcggcgtggccgaatatatcaacggcgaaaacatgaccgatttgattgaa
cgggccgacgcggcgctctacaccgccaaacacaacggccggaaccaggtcgccgccgcc
ccgaccccgatgggcaagcgcagcaacggcgcgtaa

DBGET integrated database retrieval system