KEGG   Micavibrio aeruginosavorus ARL-13: MICA_69Help
Entry
MICA_69           CDS       T01630                                 

Definition
(GenBank) diguanylate cyclase domain protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Brite
Enzymes [BR:mai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     MICA_69
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
60157..61212
Genome map
AA seq 351 aa AA seqDB search
MNYPHEAHQAREFAEKAMTRILDEGLPPSPDIYELWYVYYAGISPEVTRALDILVSNRQK
ITEDRCRDPHTRFLSDARNEEMIRRAGDQVKATIKNVTGAVRDVKNATTSYSGTLEDVSK
KMGGAKTVDEMRNLVSGVMNDTQKMLEHNHKLEQELEQSSTLMEELQRDLEQVRKEAMTD
GLTGLANRKAFDAALDRVSSDTQSEQGSFTLLMVDIDHFKSFNDNYGHQVGDQVLRLVAR
TLIEGVKGKDIAARYGGEEFAIILPDTNLTAGVAVGNNLRKAVATKDVINRTTGEKLGRI
TMSVGVAEYINGENMTDLIERADAALYTAKHNGRNQVAAAPTPMGKRSNGA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgaactatccgcacgaagcacatcaggcccgggaatttgccgaaaaagccatgacgcgc
atccttgatgaaggattgccgccgtcgccggatatttacgagctgtggtacgtctactat
gccgggatcagcccggaggtgacgcgcgcgctggacatcctggtgtccaaccgccagaaa
attaccgaagaccgctgccgcgatccgcacacgcgtttcctgagcgatgcgcggaacgag
gaaatgatccgccgcgccggtgatcaggtgaaggcgaccattaaaaatgtgaccggggct
gtgcgcgacgtgaaaaacgccaccacgtcctatagcggtacgctggaagatgtatccaaa
aaaatgggcggcgccaaaaccgtggacgagatgcgcaatctggtgtccggcgtgatgaac
gatacacagaaaatgctggaacataaccacaagctggaacaggaactggaacaatcctcc
accttgatggaagagctgcaacgcgacctggaacaggtgcggaaagaggcgatgaccgat
ggcctgaccggcctggccaaccgcaaggcttttgatgcggcgctggatcgggtcagcagc
gatacgcaaagcgaacaggggtcgttcaccctgttgatggttgatattgatcacttcaaa
tccttcaacgacaattatggtcaccaggtgggggaccaggttttgcgccttgtcgcccgc
accttgatcgaaggggtgaagggtaaggacattgccgcgcgctacggcggtgaggaattt
gcgatcatcctgcccgacacgaatttgaccgcgggtgtggccgttgggaacaatttgcgc
aaggcggttgcgaccaaggatgtgattaaccggaccacgggtgaaaaactgggccgtatt
accatgtctgtcggcgtggccgaatatatcaacggcgaaaacatgaccgatttgattgaa
cgggccgacgcggcgctctacaccgccaaacacaacggccggaaccaggtcgccgccgcc
ccgaccccgatgggcaagcgcagcaacggcgcgtaa

DBGET integrated database retrieval system