KEGG   Micavibrio aeruginosavorus ARL-13: MICA_715Help
Entry
MICA_715          CDS       T01630                                 

Definition
(GenBank) nucleotidyl transferase family protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
mai00040  Pentose and glucuronate interconversions
mai00052  Galactose metabolism
mai00500  Starch and sucrose metabolism
mai00520  Amino sugar and nucleotide sugar metabolism
mai01100  Metabolic pathways
mai01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MICA_715
   00052 Galactose metabolism
    MICA_715
   00500 Starch and sucrose metabolism
    MICA_715
   00520 Amino sugar and nucleotide sugar metabolism
    MICA_715
Enzymes [BR:mai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MICA_715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEP09049
UniProt: G2KQB3
Position
complement(703262..704161)
Genome map
AA seq 299 aa AA seqDB search
MSASKQWKPIRKAVLPVAGLGTRFLPATKVMPKEMLPLVDRPLVQHAIEEARDAGIDEFV
FITGRFKEMLEEHFDYQPELAALLESRGKPDMAEKVKASEIPAGQLFLTRQPKPLGLGHA
IWCAKKLIGDDPFAILLPDDVVLNPGGPGCLAQMIETYNQTGGNLVAVMDVPREKTASYG
ILDIKSDDGRRVDIKGLVEKPKPENAPSTLSIIGRYILQPELFTYLDKFEKGVGGEIQLT
DAMANLIGQQPFHGLRYDGQRYDCGSRVGFIEANIAFAMHDPEIGDTVKSIIKKHAQNL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcatcgaaacaatggaagcccattcgcaaagccgtcctgcccgttgccgggctg
ggcacgcgttttctacccgcgacgaaagtcatgccaaaggaaatgctccccctcgtcgat
cgcccactggttcaacacgcgattgaagaagcgcgcgatgcgggcatcgacgaattcgtc
ttcatcacgggccggttcaaggaaatgctggaagagcattttgattaccagcccgaactg
gccgccctgctggaatcccgcggcaaaccggatatggcggagaaggtcaaagcctccgaa
attcccgccgggcaattgttcctgacacgccagcccaaaccgctgggcctgggccatgcc
atctggtgcgcgaagaaactgatcggtgatgatccgtttgcgatcttgctgcccgatgat
gttgtgctgaatcccggtggtcccggatgtctggcccagatgattgaaacctataatcaa
accggtggaaatctggtcgccgtgatggatgtgccgcgcgaaaagaccgccagctacggc
attcttgatattaaatccgatgacggtagacgcgtggatattaaaggcctggtcgaaaaa
ccgaagccggaaaacgccccctccaccctgtccatcattggccgttatatcctgcagccg
gaattgttcacctatctcgataaattcgaaaaaggtgtaggcggggaaattcaattgacc
gacgccatggccaatttgattggccagcaaccgttccacggactgcgctatgacgggcag
cgttacgattgcggcagccgcgtgggctttatcgaagccaatatcgcctttgccatgcat
gacccggaaatcggcgacaccgtcaaatccatcattaaaaaacacgcccaaaatctgtaa

DBGET integrated database retrieval system