KEGG   Micavibrio aeruginosavorus ARL-13: MICA_736Help
Entry
MICA_736          CDS       T01630                                 

Definition
phosphoglycerate mutase family protein
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MICA_736
   01230 Biosynthesis of amino acids
    MICA_736
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MICA_736
  Energy metabolism
   00680 Methane metabolism
    MICA_736
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MICA_736
Enzymes [BR:mai01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     MICA_736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(722669..723292)
Genome map
AA seq 207 aa AA seqDB search
MTRTTLIIARHGNTFESGEAPRRVGCRTDLPLTTKGEDQARAIGHYIATNGYTPDVLFTS
TLQRTMRTGALALEAARIDAPSSTLPFLNEIDYGPDENQTEDHVIARLGETALQDWETNG
IMPPDWSPRPATIIDGWTTFADDIVRTRPGQCVMVVTSNGIARFAQHLCPDPDSLARAHG
LKMATGSLSVFVHDDDQWILEGWNIRP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcacaacactgatcatcgcgcgccacggcaatacatttgaaagcggcgaagcc
ccgcgccgtgttggatgccgcaccgatttgcccttaacaacaaagggcgaagatcaagcg
cgcgccatcggccactacattgccaccaacggctatacgcctgatgtattgtttacatcc
accctgcaacgcacgatgcggacgggggcgctggcactggaggcggcgcggattgatgca
ccatcatccaccctgccattcctgaatgaaattgattacggcccggacgaaaaccaaacc
gaagatcacgtcatcgcacgtctgggtgaaaccgcattacaggattgggaaacgaacggt
attatgccgcccgactggtccccgcgccccgccactatcattgatggctggaccacattt
gccgacgacattgtgcgcacccgtccgggccaatgcgtcatggtcgtcacctccaatggc
atcgcccgctttgcccaacatctgtgccccgaccctgattctctggcccgcgcgcatgga
ttgaaaatggccacggggtcattgtccgtctttgtccatgacgatgatcaatggatactc
gaaggctggaacattcgcccctga

DBGET integrated database retrieval system