KEGG   Micavibrio aeruginosavorus ARL-13: MICA_787Help
Entry
MICA_787          CDS       T01630                                 

Definition
pfkB carbohydrate kinase family protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MICA_787
Enzymes [BR:mai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MICA_787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
778048..778944
Genome map
AA seq 298 aa AA seqDB search
MDMTLPVPSMPIRGETMVIPAYEITPGGKGANQALAAARMGVQAVLVGRVGKDVYAYETI
TTIRRQGVVTSGVSEDETLPTGTAVILREPDGSNRIIVANGANKALEHDQVPDEILKPTN
MLLAQMEVAPEQVFTLIRRAHEKKVKILLNAAPACDIPADVLRMVDVLIVNEVEAARLAD
FCRLKHDNTPEGMAHALAGVTHKTCIITLGPDGSVAVLDDGSVVRVPALPIDRVVDTTGA
GDAYCGTLAALLADKMNMREALRWAAVAGSLACTKKGALSAFAYSDDIRDALKNLPLV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggatatgaccctgccggtgccgtcaatgccgatccgcggggaaaccatggtgattccc
gcttacgagatcaccccggggggcaagggcgcgaaccaggcgctggccgccgcgcgcatg
ggggtgcaggccgtgttggtcgggcgtgtgggcaaggatgtctatgcctatgaaaccatc
accaccattcgccgtcagggtgtggtgacatccggcgtatccgaagatgaaacattgcca
acgggcaccgccgtgattttgcgtgaaccggatggatcaaaccgcatcattgtggccaat
ggcgcgaacaaggcgttggagcatgatcaggttcccgacgaaattttaaaaccaaccaat
atgctgctggcgcagatggaagtggctccggaacaggtcttcaccctgatccgtcgcgcg
catgagaagaaagtgaaaattcttctgaacgcggcacccgcctgtgatatcccggcggat
gttttgcgcatggttgacgtcctgatcgtgaacgaggtcgaagcggcgcgtctggctgat
ttttgccgcttgaaacacgacaacacacccgaaggcatggcccatgcgctggccggggta
acgcataaaacatgcattattacactgggcccggatggatcggtggccgttttggatgat
ggatcggttgtgcgtgttccggcgttgccgattgatcgcgttgttgatacgaccggggca
ggggacgcgtattgcgggacgctggccgcgttgctggcggataaaatgaatatgcgtgaa
gcgttgcgctgggctgcggttgcgggctcgctcgcctgcacgaaaaaaggcgcattgagc
gcctttgcctattccgatgatattcgtgatgcgttgaaaaatttgccgctggtataa

DBGET integrated database retrieval system