KEGG   Micavibrio aeruginosavorus ARL-13: MICA_962Help
Entry
MICA_962          CDS       T01630                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MICA_962 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    MICA_962 (phbA)
   00640 Propanoate metabolism
    MICA_962 (phbA)
   00650 Butanoate metabolism
    MICA_962 (phbA)
  Lipid metabolism
   00071 Fatty acid degradation
    MICA_962 (phbA)
   00072 Synthesis and degradation of ketone bodies
    MICA_962 (phbA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MICA_962 (phbA)
   00310 Lysine degradation
    MICA_962 (phbA)
   00380 Tryptophan metabolism
    MICA_962 (phbA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MICA_962 (phbA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MICA_962 (phbA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MICA_962 (phbA)
Enzymes [BR:mai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MICA_962 (phbA)
Exosome [BR:mai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MICA_962 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
958735..959946
Genome map
AA seq 403 aa AA seqDB search
MTTNDPIVIVAAKRTPIGNFNGGLSTLPAHDLGAVAIRAVMDEAKVGGADIDEVIMGQVL
TAAAGQNPARQAAMAAGIPHDKTALTVNQVCGSGLRTVALGMQSILNGDATVIVAGGQEN
MSLSPHAMHMRNGTKMGNATMVDTMIVDGLWDAFNGYHMGMTAENIAEKWQITRADQDNF
AAASQQKTEAAQKAGKFTAEITPVKIKVKKDEVIIDKDEFPRAGVTVESLAGLRPAFKPD
GTVTAASASGINDGAAAVVLMRASEAKKRGLPVYATIRSWATAGVDPAVMGSGPIPASRK
ALEKAGWSVSDLDLVEANEAFAAQSLCVLKDLALDPAKVNVNGGAIAIGHPIGASGTRVL
VTLLHEMARRDVKRGLVTLCIGGGMGIAMCVERDASENLKKVA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaatgatcccatcgttatcgtcgccgccaaacgcacacccattggtaatttc
aatggtggcctcagcacgttgcccgcgcatgatctgggcgcggtggcaatccgcgcggtt
atggatgaagccaaagtcggcggtgccgatattgacgaagtgattatggggcaggttctc
accgccgccgccggacaaaacccggcacgtcaggctgcaatggctgcgggtatcccgcat
gacaaaaccgcactgaccgtgaaccaggtgtgtgggtctggcctgcgcactgtggcgctt
ggcatgcaatccattctgaatggtgatgcaaccgtcatcgttgcaggcgggcaagagaat
atgagcctgtccccgcacgctatgcacatgcgcaacggtacgaagatgggcaacgccacg
atggttgacacgatgatcgtcgatggcctgtgggacgcattcaacggctaccacatgggc
atgaccgccgaaaacattgccgagaaatggcaaattacacgtgcggatcaggataatttt
gccgctgcatcccagcaaaaaaccgaagccgcgcaaaaggccggtaaattcaccgccgaa
atcaccccggtgaaaatcaaggtgaagaaggatgaagtgatcattgataaagacgaattc
ccgcgcgcaggcgtgacggttgaatctctggcgggcttgcgcccggccttcaaaccggac
ggcaccgtgacggcggccagcgcatccggcatcaatgatggtgccgccgccgttgttctg
atgcgcgccagcgaagcgaagaagcgtggccttccggtttatgcgaccattcggtcctgg
gccacggcgggtgttgatccggcggtgatgggctccggtccgatcccggcatcgcgcaag
gcgttggaaaaagcgggctggtccgtatccgacctggatctggtcgaagcgaacgaagct
ttcgccgcacaatctctgtgcgtgttgaaggatctggcgttggacccggcgaaggtcaac
gtgaatggtggggccattgccatcggtcacccgattggtgcatcgggcacacgcgttctg
gtcacgctgctgcatgaaatggcgcgccgtgatgtgaaacgcggtctggtgacattgtgc
atcggcggcggcatggggattgccatgtgcgttgagcgcgatgcctccgaaaatctgaaa
aaagttgcttaa

DBGET integrated database retrieval system