KEGG   Micavibrio aeruginosavorus ARL-13: MICA_969Help
Entry
MICA_969          CDS       T01630                                 

Definition
phosphofructokinase family protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MICA_969
   01230 Biosynthesis of amino acids
    MICA_969
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MICA_969
   00030 Pentose phosphate pathway
    MICA_969
   00051 Fructose and mannose metabolism
    MICA_969
   00052 Galactose metabolism
    MICA_969
  Energy metabolism
   00680 Methane metabolism
    MICA_969
Enzymes [BR:mai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MICA_969
Protein phosphatases and associated proteins [BR:mai01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MICA_969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
967103..968182
Genome map
AA seq 359 aa AA seqDB search
MAAKRIGILTSGGDCAGLNAIIRGAVHAAHKKGWETVGILNGTAGLFKTPPAVRTLTPLE
IDGQIMRQGGTILGTTNKGNPFAFPMADGSLKDRSGEIVDGFKALGLDAIIGIGGDGSFA
ILSKLAKQGGINMVGIPKTIDNDIGMTEFSVGFDTAVAVATEALDRLQPTAASHDRVMIL
EVMGRDAGHIALAAGIAGGADVILIPEIPYSIESVAKKIKAVKDSGRNFALVVVSEAVKT
TDGGKVQTEYTDGEKRYGGIGQYIGAQIAEATGSETRVTVLGHVQRGCPPSYNDRLLGTA
FAVKAVDLIEEGKFGRMVAWQNRQVIDVAIEDAIAAYQQVDIDSTLVHTCRALGISLGD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaaacgcatcggtattctgaccagtggcggcgattgcgcggggttgaacgcg
attattcggggcgcggttcacgccgcccataaaaagggctgggaaaccgttggtattctg
aacggcacagcgggtttgtttaaaacgcctccggctgtgcgcacgctgaccccgctggaa
attgacgggcagatcatgcgccaggggggcacgattctggggaccacgaacaagggcaac
ccgttcgcgttcccgatggcggatgggtcgttgaaggatcgttcgggcgaaatcgtcgac
gggttcaaggctctggggctggacgccattatcggtatcggcggtgacggcagcttcgcg
attttaagcaagctggcgaagcagggcggcatcaacatggtgggcatcccgaaaaccatt
gataacgatatcggcatgaccgaattttccgtcggttttgatacggctgttgcggttgcg
accgaggcgctggatcgcctgcaacccacagcggccagccatgaccgcgtgatgattttg
gaagtcatgggccgcgatgcgggccatatcgctctggccgccggtattgcgggcggtgcg
gatgtcatcctgatccctgaaattccatatagcatcgaaagcgtggcgaagaagatcaag
gccgtgaaggattccggccgtaacttcgctctggtcgttgtctccgaagccgtaaaaacg
accgatggcggcaaagttcaaaccgaatacacagacggcgaaaagcgctatggcggtatt
ggccagtacatcggcgcgcaaattgccgaggccacagggtccgaaacccgcgtcacggtg
ctgggtcacgtgcaacgcggatgcccgccaagctataatgaccgtttgctgggcaccgcc
tttgcggtcaaggccgttgatttgatcgaagagggtaaattcgggcgtatggtggcctgg
cagaatcgccaggtgatcgatgtggcgatcgaagatgccatcgccgcgtatcagcaggtg
gatattgacagcactttggtgcatacttgtcgtgcactggggatttctttgggggactga

DBGET integrated database retrieval system