KEGG   Micavibrio aeruginosavorus ARL-13: MICA_969Help
Entry
MICA_969          CDS       T01630                                 

Definition
(GenBank) phosphofructokinase family protein
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MICA_969
   00030 Pentose phosphate pathway
    MICA_969
   00051 Fructose and mannose metabolism
    MICA_969
   00052 Galactose metabolism
    MICA_969
  Energy metabolism
   00680 Methane metabolism
    MICA_969
Enzymes [BR:mai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MICA_969
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     MICA_969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
967103..968182
Genome map
AA seq 359 aa AA seqDB search
MAAKRIGILTSGGDCAGLNAIIRGAVHAAHKKGWETVGILNGTAGLFKTPPAVRTLTPLE
IDGQIMRQGGTILGTTNKGNPFAFPMADGSLKDRSGEIVDGFKALGLDAIIGIGGDGSFA
ILSKLAKQGGINMVGIPKTIDNDIGMTEFSVGFDTAVAVATEALDRLQPTAASHDRVMIL
EVMGRDAGHIALAAGIAGGADVILIPEIPYSIESVAKKIKAVKDSGRNFALVVVSEAVKT
TDGGKVQTEYTDGEKRYGGIGQYIGAQIAEATGSETRVTVLGHVQRGCPPSYNDRLLGTA
FAVKAVDLIEEGKFGRMVAWQNRQVIDVAIEDAIAAYQQVDIDSTLVHTCRALGISLGD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaaacgcatcggtattctgaccagtggcggcgattgcgcggggttgaacgcg
attattcggggcgcggttcacgccgcccataaaaagggctgggaaaccgttggtattctg
aacggcacagcgggtttgtttaaaacgcctccggctgtgcgcacgctgaccccgctggaa
attgacgggcagatcatgcgccaggggggcacgattctggggaccacgaacaagggcaac
ccgttcgcgttcccgatggcggatgggtcgttgaaggatcgttcgggcgaaatcgtcgac
gggttcaaggctctggggctggacgccattatcggtatcggcggtgacggcagcttcgcg
attttaagcaagctggcgaagcagggcggcatcaacatggtgggcatcccgaaaaccatt
gataacgatatcggcatgaccgaattttccgtcggttttgatacggctgttgcggttgcg
accgaggcgctggatcgcctgcaacccacagcggccagccatgaccgcgtgatgattttg
gaagtcatgggccgcgatgcgggccatatcgctctggccgccggtattgcgggcggtgcg
gatgtcatcctgatccctgaaattccatatagcatcgaaagcgtggcgaagaagatcaag
gccgtgaaggattccggccgtaacttcgctctggtcgttgtctccgaagccgtaaaaacg
accgatggcggcaaagttcaaaccgaatacacagacggcgaaaagcgctatggcggtatt
ggccagtacatcggcgcgcaaattgccgaggccacagggtccgaaacccgcgtcacggtg
ctgggtcacgtgcaacgcggatgcccgccaagctataatgaccgtttgctgggcaccgcc
tttgcggtcaaggccgttgatttgatcgaagagggtaaattcgggcgtatggtggcctgg
cagaatcgccaggtgatcgatgtggcgatcgaagatgccatcgccgcgtatcagcaggtg
gatattgacagcactttggtgcatacttgtcgtgcactggggatttctttgggggactga

DBGET integrated database retrieval system