KEGG   Micavibrio aeruginosavorus ARL-13: MICA_969Help
Entry
MICA_969          CDS       T01630                                 

Definition
phosphofructokinase family protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:mai01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mai01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mai00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mai00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mai00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mai00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:mai00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
967103..968182
Genome map
AA seq 359 aa AA seqDB search
MAAKRIGILTSGGDCAGLNAIIRGAVHAAHKKGWETVGILNGTAGLFKTPPAVRTLTPLE
IDGQIMRQGGTILGTTNKGNPFAFPMADGSLKDRSGEIVDGFKALGLDAIIGIGGDGSFA
ILSKLAKQGGINMVGIPKTIDNDIGMTEFSVGFDTAVAVATEALDRLQPTAASHDRVMIL
EVMGRDAGHIALAAGIAGGADVILIPEIPYSIESVAKKIKAVKDSGRNFALVVVSEAVKT
TDGGKVQTEYTDGEKRYGGIGQYIGAQIAEATGSETRVTVLGHVQRGCPPSYNDRLLGTA
FAVKAVDLIEEGKFGRMVAWQNRQVIDVAIEDAIAAYQQVDIDSTLVHTCRALGISLGD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaaacgcatcggtattctgaccagtggcggcgattgcgcggggttgaacgcg
attattcggggcgcggttcacgccgcccataaaaagggctgggaaaccgttggtattctg
aacggcacagcgggtttgtttaaaacgcctccggctgtgcgcacgctgaccccgctggaa
attgacgggcagatcatgcgccaggggggcacgattctggggaccacgaacaagggcaac
ccgttcgcgttcccgatggcggatgggtcgttgaaggatcgttcgggcgaaatcgtcgac
gggttcaaggctctggggctggacgccattatcggtatcggcggtgacggcagcttcgcg
attttaagcaagctggcgaagcagggcggcatcaacatggtgggcatcccgaaaaccatt
gataacgatatcggcatgaccgaattttccgtcggttttgatacggctgttgcggttgcg
accgaggcgctggatcgcctgcaacccacagcggccagccatgaccgcgtgatgattttg
gaagtcatgggccgcgatgcgggccatatcgctctggccgccggtattgcgggcggtgcg
gatgtcatcctgatccctgaaattccatatagcatcgaaagcgtggcgaagaagatcaag
gccgtgaaggattccggccgtaacttcgctctggtcgttgtctccgaagccgtaaaaacg
accgatggcggcaaagttcaaaccgaatacacagacggcgaaaagcgctatggcggtatt
ggccagtacatcggcgcgcaaattgccgaggccacagggtccgaaacccgcgtcacggtg
ctgggtcacgtgcaacgcggatgcccgccaagctataatgaccgtttgctgggcaccgcc
tttgcggtcaaggccgttgatttgatcgaagagggtaaattcgggcgtatggtggcctgg
cagaatcgccaggtgatcgatgtggcgatcgaagatgccatcgccgcgtatcagcaggtg
gatattgacagcactttggtgcatacttgtcgtgcactggggatttctttgggggactga

DBGET integrated database retrieval system