KEGG   Micavibrio aeruginosavorus ARL-13: MICA_978Help
Entry
MICA_978          CDS       T01630                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MICA_978
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MICA_978
   00650 Butanoate metabolism
    MICA_978
  Lipid metabolism
   00071 Fatty acid degradation
    MICA_978
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MICA_978
   00310 Lysine degradation
    MICA_978
   00360 Phenylalanine metabolism
    MICA_978
   00380 Tryptophan metabolism
    MICA_978
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MICA_978
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MICA_978
   00281 Geraniol degradation
    MICA_978
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MICA_978
   00627 Aminobenzoate degradation
    MICA_978
   00930 Caprolactam degradation
    MICA_978
Enzymes [BR:mai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MICA_978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
978723..979829
Genome map
AA seq 368 aa AA seqDB search
MASQIITDPHLRVETHGSVGFLTLDRPQALNALTLGMIRGIHAALEAWRDDDGIRAIIIR
GAGDRAFCAGGDVKAVYEAGVNVTDPDAKTAIARVYFADEYRMNRALFHFPKPIVAFMNG
ITMGGGYGVAGPCRFRIASEKTLFAMPEVGIGFFPDVGSVYFLTRASSPGVGLWLALTGQ
AVPASDMVYAGLADAFVPSADHDDLVTSIIHAANASTDARTAEVAIAALLPSGRGGAGAS
ALARHAEAVAEVFKLESHLEKILQDSETSGNSFLNETARIVKTRAPLSLKITHEYMRRMQ
GASFDAVTAMDYRLAIAFMRDHDFYEGIRAALVDKDKDPHWSPAALGQVSSAMVDAYFSD
NYPDLDAA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcatcacagatcataaccgacccgcatttgcgcgttgaaacccacggatccgttggg
tttttgacactggatcgtccccaagcgttgaatgcgctgaccctggggatgatccggggt
atccacgcggcgttggaggcttggcgggatgatgatggtattcgggccattattatccgt
ggcgcgggggatcgtgccttttgcgcgggaggggatgtgaaggctgtgtacgaggcgggt
gtgaatgtgacggatcctgatgccaaaaccgccatcgcccgtgtgtattttgccgatgaa
taccgcatgaaccgggccttattccatttcccgaagccgattgtcgcatttatgaatggc
attacgatgggcggtgggtatggtgttgccgggccgtgtcgtttccgtatcgcgtccgag
aaaacgttgtttgccatgccggaggtggggattggatttttccctgatgtggggtcggtc
tattttctgacgcgggcctcatcacccggtgtagggctgtggctggccttaacgggtcag
gctgtgcctgcgtccgacatggtgtatgccgggttggcggatgcgttcgtcccgtcggct
gaccatgatgatctggtgacgtccataattcatgccgcgaatgccagtaccgatgcgcgc
acggcggaggtcgccattgcggccttgttgccatccggaaggggcggggctggtgcctcc
gcgctggcgcgccatgcagaggctgtggcggaggtttttaaactagaatctcaccttgag
aaaattctgcaagactctgaaacttcagggaatagttttttaaacgaaacggcgcgtatt
gtaaaaacgagggcgccactcagcctgaaaatcacccatgagtatatgcgccggatgcag
ggcgcgtccttcgatgcggtcacggcgatggattatcgtctggccatcgcctttatgcgc
gatcatgatttttacgaaggcattcgtgctgcgctggtcgacaaggataaagacccgcat
tggagtccggcagcgctggggcaggtgagttctgctatggtcgatgcgtatttttcagat
aactatcccgatctggatgcggcttaa

DBGET integrated database retrieval system