KEGG   Metarhizium anisopliae: MAA_02507Help
Entry
MAA_02507         CDS       T03107                                 

Definition
repressible alkaline phosphatase precursor
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
maj  Metarhizium anisopliae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MAA_02507
Enzymes [BR:maj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MAA_02507
Exosome [BR:maj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAA_02507
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 563 aa AA seqDB search
MESEQSPLLGNENQSHENGRRHHSRRDSRWSRLREIGIFVWALIATAAVIIIAIATQHDQ
QTSRPDPDPRPTKRNLVFMVSDGMGPASLSLTRSYRQHVEGLPEHDTLVLDKHFWGSSRT
RSSSSLVTDSAAGATAFSCGKKSYNGAISMLPDFQPCGSVLEAAKRAGYATGLVVTTDIT
DATPACFASHVLIRQMQDAIALQEVGHGPLGRSVDLMLGGGRCHFMPNSTAGSCRLDDID
VVALAQEKYGWSYADSRQAFDALHAGQNVNLPLLGLFASSDIPFELDRRNMNDVYPSLSE
MAQTALRTLEKATDKSDKGFFLMIEGSRIDHAGHINDPAAQVREVLEYDKTFKAVLDFID
DTTTETILVATSDHETGGLATALQEPGHLPVYNWYPHVLANVSASCESLAKSLQSHVSNM
PASISKQQLKSWINEKLVIPGLGVTDATDDELSLLANDPEASVNTFAAIISLRAHVGWST
HGHTAVDVNVYSSGGPETERIRGNVENTEIGHFLSHYLEVDVDEITQELQQKARISDDNS
FHATQDPKETGDWASGKYHTFED
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggagtctgagcaaagcccactcctcggcaacgagaaccaatcccatgaaaatggcaga
cgtcatcatagccgaagggattcaaggtggtcacgactccgcgaaatcggaattttcgtt
tgggccttgatcgctactgctgccgtcattatcatagccatcgccacccagcatgatcaa
cagacgtccaggccagaccccgaccctcgaccaaccaagcgcaatcttgtctttatggtc
tcagatggcatgggccctgcctcactatcactgacccgcagctatcgtcagcacgtcgag
ggtctccctgagcacgacacactcgtcttggacaagcacttctggggctctagtcggaca
cggtctagcagctccctggtcaccgacagtgccgctggtgccaccgccttctcctgcggc
aaaaagagctacaatggtgccatttcaatgcttcccgactttcagccttgtggctctgtt
ctcgaagctgcaaagagggccgggtacgccacgggtctggtcgtcactaccgacatcacc
gacgcaactccggcctgttttgcaagtcatgtcctgattaggcagatgcaggacgccatt
gccttgcaagaagtcggtcatggacctcttggccgctcagttgacctcatgctaggtggt
ggacgatgccatttcatgcccaactctactgccggtagctgtcgtttggatgacattgat
gtcgttgccttggcgcaggaaaagtatgggtggtcgtatgccgacagccgccaggctttc
gatgctctccatgcaggtcaaaatgtcaacttgccgttattaggattgttcgcctcatca
gacatccctttcgaactggacagaaggaacatgaatgacgtttatccaagtctcagcgaa
atggcccagactgcactacgtactctggaaaaggctactgacaaaagcgataaaggcttt
ttcctcatgatcgagggtagccgaatcgatcatgctggccacatcaatgatcccgccgct
caggtacgagaggtcctggaatacgataaaacattcaaggccgtgttggatttcatcgat
gacactactactgaaaccattctcgttgcaaccagtgaccatgagaccggtgggctggct
accgctctccaggagcctggccaccttccagtttataactggtatccgcatgtactcgcc
aatgtctctgcctcgtgcgaaagcctggctaagtcgttacagagtcatgtgtccaacatg
cctgcttctatttccaagcaacagctcaaatcatggataaacgaaaagcttgttattccc
ggcctgggtgtcactgatgccaccgatgatgagctttcgcttcttgctaatgaccccgag
gcttctgtcaatacctttgctgctattatctctcttcgtgcacacgttggctggagcacg
catggtcacacagccgtcgacgtcaatgtctacagctctggcggcccagagactgaacga
attcgaggcaacgttgagaataccgaaataggacactttctcagccactatctagaggta
gatgttgatgagatcacacaggaacttcaacagaaagctcggatcagcgacgacaacagt
tttcatgcaactcaggatccaaaagagactggagattgggcgtccggtaagtatcatacc
tttgaagactga

DBGET integrated database retrieval system