KEGG   Metarhizium robertsii: MAA_05428Help
Entry
MAA_05428         CDS       T03107                                 

Definition
(RefSeq) oxidoreductase NAD-binding domain-containing protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
maj  Metarhizium robertsii
Pathway
maj00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:maj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MAA_05428
Enzymes [BR:maj01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     MAA_05428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 19259714
NCBI-ProteinID: XP_007821617
UniProt: E9EZH9
AA seq 296 aa AA seqDB search
MTTRILSRSRPAAILGTIAAASLAVGITTKFLIQDARADSRASPPKVFGGGPAFFSLPLE
SADMVNHNTRLLRFKFADKEAVSGLPVNSSVLALSWPEGRWFPVIRPYTPISATDEQGHL
DLMVKHYPDGKSSTHLHKLQPGESLFFVASLKGHRWKADAFPHVTLIAGGAGITPIYQLT
QAILRNPQDKTAVTLVFGVNSDRDVLLKEEFQEWEKKFPGRFKAVYTVSNPVEGSPYRKG
YVTKDLLREVTPSPAGNETMVFVCGPPSMEKALVGDGRRRGILQELGYRKDQICQF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgcggatcctcagtcgctcgcggcccgcagccattctgggcaccatcgctgcc
gcatcgcttgccgtcggcatcaccaccaagttcctcatccaagatgctcgggccgactcg
cgagcgtcgccgccaaaggtctttggaggcggaccggccttcttttcgctgccgctggag
agcgcagacatggtcaaccacaacacgcggctgctgaggttcaagtttgccgacaaggag
gctgtcagcggattacccgtgaactcgtcagtattggccctgtcgtggccggaagggaga
tggtttccagtcatacggccgtatacccccatcagcgcaaccgatgaacaaggccacctg
gacctcatggtcaagcactaccccgacggcaaatccagcacccatctgcacaagctgcag
ccgggcgagtccctcttcttcgtcgcctcgctcaagggccaccggtggaaagccgacgcc
ttcccgcacgtcactctcattgctggcggggccggaatcacgcccatctaccagttgacg
caggccattctgcgcaatccccaggacaagacggccgtgactctggttttcggcgtcaac
agcgaccgggatgtcctgctcaaggaggagttccaggagtgggagaagaagttccccggg
aggttcaaggccgtatacacggtgagcaaccctgttgagggatcgccgtacaggaagggg
tatgtgaccaaggacttgttgagagaggtgacgccctcgccggcaggaaacgagacaatg
gtgtttgtttgcgggccgccgagcatggagaaggccttggtcggcgatggcaggagacgt
gggatattgcaggaattggggtatagaaaggaccagatttgccagttctag

DBGET integrated database retrieval system