KEGG   Metarhizium anisopliae: MAA_07007Help
Entry
MAA_07007         CDS       T03107                                 

Definition
alkaline phosphatase, putative
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
maj  Metarhizium anisopliae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MAA_07007
Enzymes [BR:maj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MAA_07007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 577 aa AA seqDB search
MRPQSLLCVTSLLAGTATASFDGNVNYDSPSRRHESLGIDVGLVERRSWKRGNVAHEPSQ
LHFTHGIASGDPWPESVILWTRVAPRNESDKSEATVNGTAPLWSHETDKYIKADANPICV
EWKVFQSKRANSTSQKVVASGKAYTTSDIDYTVKVEAKGLKPLTTYFYQFNVCASSNKSP
VGRTKTAPAKDDAVSKLSFAVFSCSNFPNGYFNAYGNAARKDKHDYAIHLGDYLYETGRG
GERATKPSGTIWTLGDYRTRHGLYRSDADLQLLSQNSPWITTWDDHEFADNGYRDGFSGL
NNTEDSFLKSGTKVTVDTRKVHAVRAYFEWMPIREIADDPSRSLMGARQENWFYQSLSQS
KERGATWRIIGNQIVFSRILQNDNRGLNGDAWDGYIANRNRTLQHMYDNKIDNNIFLAGD
SHQNWVSDLAWLGNKPYDKATGNGAIGVELAGTAVSSSGQNGPIEPIAGDSARSLVKRNE
ELGWQEGYYRGYFELTITPDKATAQYYGCPTVATRNGWDLPLANFSIVAGGNHLERPIAG
GKVESGALRDGQVKHSNLTLNTNTGEWEVIGFEKMYL
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaggcctcagtccttgctttgcgtaacaagcctcctggccggcacggctactgccagc
ttcgacggcaacgtcaactacgacagcccgtctaggcgccatgagagcctgggcattgac
gttggccttgtcgagcgtcggtcatggaagcgcggcaacgtggcccatgagccgtcgcag
ttgcacttcacccatggcattgcctctggcgacccgtggcccgagagtgtcatcctctgg
acccgtgttgcccctcgaaacgagtctgacaagagcgaggcaactgtcaatggaacggct
cctctctggagccatgagacggacaagtatatcaaggctgatgctaaccccatctgcgtc
gagtggaaggtgtttcaaagcaagcgcgcgaatagcaccagccagaaggttgtggctagc
ggcaaggcatacacgacctcggacattgattataccgtcaaggtcgaggccaaggggctc
aaacccttgaccacgtacttttatcagtttaacgtttgcgcatcttccaacaagagcccc
gttggccgtaccaagactgcgcctgccaaggacgatgctgtttccaagttgagctttgca
gtgttttcttgcagcaactttcctaatggctatttcaacgcttatggcaatgccgcaagg
aaggataagcacgactatgccatccaccttggtgactacctttatgagactggaaggggt
ggtgagcgtgctaccaaaccctctggaaccatttggactctaggcgactataggactcgc
cacgggctgtatcgaagcgatgccgatttgcagctcttgtctcagaactccccctggatc
actacatgggatgaccacgagtttgcagataatggctacagggatggcttcagtggtctt
aataacactgaggactcattcctcaagtctggtaccaaagttactgtcgatacacgcaaa
gtacatgctgttcgcgcctatttcgagtggatgccaattcgcgagattgcagatgacccg
agccgctcgttgatgggagcacgtcaggaaaactggttttaccagtctctcagtcagtcc
aaggagcgaggtgccacatggcgcattattggtaaccagattgttttctcgcgcatcctg
cagaacgacaaccggggtctaaatggcgacgcctgggacggctacattgccaaccgcaac
aggaccctgcaacacatgtacgacaacaagattgacaacaacatcttcctggcgggagac
tctcaccagaactgggtgtctgatctcgcctggcttggaaacaagccgtacgacaaggcg
acgggaaacggagccattggcgtagaactcgccggcacggccgtcagctccagtggtcaa
aatggacctatcgagcctattgccggtgacagtgctcgaagcctggtgaagcgcaacgaa
gagcttgggtggcaggaaggctattaccgtggatactttgagttgacgattacgcctgac
aaggcgactgcccagtactacggctgccctaccgtcgcgaccagaaacggctgggatctt
cccctggccaactttagcattgttgcgggcgggaatcacctggagcgtccgattgctggt
gggaaggtcgagtcgggggcgctgagagacggccaggtcaaacatagcaacttgacgctg
aatacgaataccggcgagtgggaggttattggttttgagaagatgtacttgtag

DBGET integrated database retrieval system