KEGG   Metarhizium anisopliae: MAA_08759Help
Entry
MAA_08759         CDS       T03107                                 

Definition
alpha-amylase A type-3 precursor
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
maj  Metarhizium anisopliae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MAA_08759
Enzymes [BR:maj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MAA_08759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 461 aa AA seqDB search
MKPSLPTTLTLLAQLAHAADKNAWKSRSIYFALTDRIARSSSDNGGDPCGNLGDYCGGTF
QGLEGKLDYIRGMGFDAIWITPVVANAAGGYHGYWAQDLYAINAHYGSANDLKKLVDAAH
EKQMYVMIDVVANHMGPSALASRQPSPLDQASSYHPPCPIDYSNQTSIENCQIANLPDLD
TQSPAIRRLYRDWIQWLVREYAPDGVRIDTVKHVEHDYWAGFASAAAVYTLGEVFHGDPA
YVARYAGSMPGLLNYPVYYPLTDFFQQRGHPQALVDMHDRVGAAFPDPSALGTFLDNHDN
PRFLHQRGDNVALLKNALAYVLLARGVPVVYYGTEQGFAGAADPENREDLWRSGFGTGGD
LYGFIGKLTGVKKAAGGLARDDHVHLFVDETAYAWSREGGRVMVLTSNIGRGHTREYCFF
TRRPGGRWEGVLDGETYAADGEGRLCATVRDGAPVVFRGLM
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaagccatcgttgccaacaacgctcactttgctggcgcagctcgcccacgccgccgac
aagaacgcctggaaatcgcgaagcatctacttcgccctgacggaccgcattgcccgaagc
agcagcgacaatggcggcgacccgtgcggcaacctgggcgactactgcggcggcacgttc
cagggactcgaggggaagctcgactacatcaggggcatgggatttgacgccatctggatc
acgcccgtggtggccaatgccgccggcggctaccacggatactgggctcaagacctgtac
gccatcaatgcccactacggcagcgcaaacgacttgaagaagctcgtcgacgccgcccac
gaaaagcaaatgtacgtcatgatagacgtggtagcaaaccacatgggcccgtccgccctc
gcctcccgccagccctcccccctcgaccaagcgtcgtcctaccaccccccctgcccgatc
gactactccaaccagacgtccatcgagaactgccaaatcgccaacctccccgacctcgac
acgcagtcgcccgccatccgccgcctctaccgcgactggatccagtggctcgtcagggag
tacgcccccgacggcgtccgcatcgacacggtcaagcacgtcgagcacgactactgggcg
ggcttcgcctccgccgccgccgtctacaccctcggcgaggtgttccacggcgacccggcc
tacgtcgcccgctacgccggctccatgcccggcctgctcaactaccccgtgtactacccg
ctcaccgacttcttccagcagcgcggccacccccaggccctggtggacatgcacgaccgc
gtgggcgccgcgttcccggacccctcggccctgggcacctttctcgacaaccacgacaac
ccgcgcttcctccaccagaggggcgacaacgtggcgctgctcaagaacgcgctcgcctac
gtgctcctcgcgcgcggcgtgcccgtcgtgtactacggcacggagcagggcttcgcgggc
gccgcggacccggagaacagggaggacctgtggaggagcggcttcggcacgggcggcgac
ttgtacgggtttattggcaagctgacgggcgtgaagaaggcggccggcgggctggcgcgc
gacgaccacgtccacctgtttgtggacgagacggcgtacgcgtggagcagggagggcggc
agggtgatggtgctgacgagcaatatcggacgggggcacacgcgcgagtactgcttcttc
acgcggaggccgggcgggcggtgggagggcgtgctcgacggggagacgtatgcggccgac
ggggaggggaggctgtgcgcgactgtgagggacggggcgccggttgtgtttagggggctg
atgtag

DBGET integrated database retrieval system