KEGG   Metarhizium robertsii: MAA_09371Help
Entry
MAA_09371         CDS       T03107                                 

Definition
(RefSeq) steroid 5 alpha-reductase
  KO
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
maj  Metarhizium robertsii
Brite
Enzymes [BR:maj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     MAA_09371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 291 aa AA seqDB search
MAIVEGWYPPTRENWETTVLTFQILYPALSLMQLFISWYGMGKTSVRSAFNLPGRVAWVL
MEMPGFTTVLYMMKTLPRMHGIDDLPWQNRVLAGLFVIHYIYRAVVFPLIQPSMSPIHVL
VALMAAGFQVLNGVGIGAWLAAYGPVTAEAWAARSSVAQFCVGIAIFYVGLAANFFHDEE
LREIRRAEKRRRQRVLDKQGGAGGAASVEKHYQIPQAGLFKHVLYAHYLCEWVEWFGFLV
AAGWGCVPAWTFLVNEVFAMLPRAVKGKKWYVEKFGEDKIRKRWAVLPGVV
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggccattgtcgagggctggtaccctcccacgagggagaactgggagacgacggtgctc
accttccagatactctaccccgctctctcgctcatgcagctcttcatctcgtggtacggc
atgggcaagacgtcggtgcgcagcgccttcaacctccccggccgcgtggcctgggtgctg
atggagatgcccgggttcacgacggtgctgtacatgatgaagacgctgccgcggatgcac
ggcatcgacgacctgccgtggcagaaccgcgtgctggccggcctattcgtcatccactac
atctacagggccgtcgtgttccccctcatccagccgtccatgtcgccgatccacgtgctc
gtcgccctcatggccgcgggcttccaggtccttaacggcgtcggcatcggcgcctggctc
gccgcctacgggcccgtcacggccgaggcctgggccgcgcgctcctcggtcgcccagttc
tgcgtcggcatcgccatcttctacgtcggcctggcggccaacttcttccacgacgaggag
ctgcgcgagattcggcgcgccgagaagcgccgccggcagcgggtgctggacaagcagggg
ggcgcggggggcgccgccagcgtcgagaagcactaccagatcccgcaggctgggctgttc
aagcacgtcctttatgcgcactacctgtgcgagtgggtggagtggtttgggttcttggtg
gccgctggctgggggtgcgtgcctgcctggaccttcttggtcaatgaggtctttgccatg
ctgccgcgggccgtcaagggcaagaagtggtatgtcgagaagtttggggaggacaagatt
cgcaagaggtgggcggttttgcccggcgttgtgtag

DBGET integrated database retrieval system