KEGG   Mycobacteroides abscessus subsp. abscessus: LH56_18655Help
Entry
LH56_18655        CDS       T03341                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mak  Mycobacteroides abscessus subsp. abscessus
Pathway
mak00071  Fatty acid degradation
mak00072  Synthesis and degradation of ketone bodies
mak00280  Valine, leucine and isoleucine degradation
mak00310  Lysine degradation
mak00362  Benzoate degradation
mak00380  Tryptophan metabolism
mak00620  Pyruvate metabolism
mak00630  Glyoxylate and dicarboxylate metabolism
mak00640  Propanoate metabolism
mak00650  Butanoate metabolism
mak00900  Terpenoid backbone biosynthesis
mak01100  Metabolic pathways
mak01110  Biosynthesis of secondary metabolites
mak01120  Microbial metabolism in diverse environments
mak01130  Biosynthesis of antibiotics
mak01200  Carbon metabolism
mak01212  Fatty acid metabolism
mak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mak00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LH56_18655
   00630 Glyoxylate and dicarboxylate metabolism
    LH56_18655
   00640 Propanoate metabolism
    LH56_18655
   00650 Butanoate metabolism
    LH56_18655
  Lipid metabolism
   00071 Fatty acid degradation
    LH56_18655
   00072 Synthesis and degradation of ketone bodies
    LH56_18655
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LH56_18655
   00310 Lysine degradation
    LH56_18655
   00380 Tryptophan metabolism
    LH56_18655
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LH56_18655
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LH56_18655
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LH56_18655
Enzymes [BR:mak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LH56_18655
Exosome [BR:mak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LH56_18655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M22 Thiolase_N GYD
Motif
Other DBs
NCBI-ProteinID: AIR44587
UniProt: A0A1N5TV49
Position
3775820..3776974
Genome map
AA seq 384 aa AA seqDB search
MSRGVAVIGVGQSKQAKKREVTIAALVREAVDGALADAELTFGDIDAIVLAKTPDLFDGV
MNPELYLADAIGARGLPVTRVFTGGSVGGHAAIYAAHLIQARLAGRVLVVAYSKESEGNF
TWALSRPLPFSAQLGAGAGGHFAPVIREYIRRSQAPEHIGWQVAVNHRLNATRNPYAHIH
KPDITIEEVRSSPMLWDPIRFLESCPSSDGSCAVVISSEMHARLAPRPPAWIHGTGWRTE
TGHFAGRDEVNPRAGQECAAAAYREAGITDPGTEVDVSELYIPYSWYEPMWMENIGLAPE
SSGWRAVDEGHTAFGGRHPINPSGGVLSGNPTGATGLLRFAEAALQVRGLAGEHQVDGAR
RAIGHAMGGASQFHALWVVGSEKP
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcggtgtcgccgtcattggcgtcgggcaaagcaagcaagccaaaaaacgtgag
gtgaccatcgccgcactggtccgcgaagcggtggacggggcgctggccgacgccgagctg
accttcggcgacatagacgcgatcgtgctggctaagactcccgatctattcgacggcgtc
atgaacccggagctgtacctcgccgacgcaatcggcgcgcggggtctgccggtcacgcgc
gtattcaccggtggcagcgtcggcggtcacgccgccatctacgccgcgcacctgatccag
gcccggctggccggacgggtattggtggtcgcgtactccaaagagtccgagggcaatttc
acgtgggcactgtcacgtccgttgccattcagtgcccagttgggagccggcgcaggcggc
cacttcgcaccggtgatccgggagtacatccgccgctcgcaggcaccggaacatatcggc
tggcaggtggcggtgaatcatcgcctcaacgccacccggaacccctacgcgcatatccac
aagcccgatatcaccatcgaggaggtgcgcagctccccgatgctgtgggacccgatccga
ttcctggagtcgtgcccgtcctcggatggctcgtgtgccgtcgtgatttcttcggagatg
catgcgcgcctcgctccccgaccgccggcctggattcatggcaccggatggcgcaccgaa
acaggacatttcgcgggccgagacgaagtgaacccgcgtgctggacaggagtgcgccgcc
gccgcgtatcgcgaggcgggcatcaccgatcccggcaccgaagtggatgtctccgagctc
tacattccctacagctggtatgagccgatgtggatggagaacatcggtctggcaccggag
agttcgggctggcgcgccgttgatgagggccacaccgcattcgggggccggcacccgatc
aacccgtccggaggggtgctctccggcaatccgaccggtgccaccggcctactccgattc
gccgaggccgcactgcaggtgcgggggctcgcgggtgaacaccaggtcgatggcgccagg
cgtgcgataggccacgccatgggcggggcgtcacagttccacgcgttgtgggtggtggga
agtgagaaaccatga

DBGET integrated database retrieval system